CAZyme Information: ASPVEDRAFT_75048-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_75048-t33_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560		61459.74	5.1448

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878133:1057017-1059089(-)

Full Sequence      

MHLSIVVSVLSLLGRVLAGSGSTETSGASHSVSFVNKHNYYFDVDGNVVNSVNGKVDWID
EQYFWVVNASLSYSSRDLVNWYRNPTELFNISQPVNAQACSGIFGSCDRPKVIYNEKTRK
YVLMAFAAPGSEPGIPVFTSDHLTHGYTFQGHLIQKTWWPGQGVEDLSLAVIDGEGYVIY
TTWDMISAIVTDGTLGSIWPAFSQTVVIERLTDDFLHTTGDTSIVIQEGGDFPVTANSSN
LVDGQVESPDIFKREDWWYMVGSGTCSFCNGTTTVAYRSKSWKGPWTFQFVDSDLTCGGQ
GMGVMTVPRVNNTEQQFLYQADRPSVAPLGLGYTGGAIGHGFWKLNFNPDGSINKIDCSP
DAQTTIQAPIGRKDIPSTGLATTATDGSGNNKDYWAESNYPSAWFYQTWTSSKSGNLSSV
GINLSAISPSRALSVFVFRYPGEADFTAPFFKWETLGWTPVTSDNVTLSLDVVQVPVGAS
VKKGDRLGFALTVGYPMKKAPSLPRSSQTASVWGYLMTDQVEDGHVLYALNKSHVSFQEG
YKSPVRVLENRELKWYARVD

Enzyme Prediction     

EC	3.2.1.145:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH43	72	307	1.5e-29	0.8553719008264463

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
350145	GH43_CtGH43-like	1.24e-41	54	347	6	282	Glycosyl hydrolase family 43 protein similar to Clostridium thermocellum exo-beta-1,3-galactanase CtGH43 and Ruminococcus champanellensis arabinanase Ara43A. This uncharacterized glycosyl hydrolase family 43 (GH43) subgroup belongs to a subgroup which includes characterized enzymes with exo-beta-1,3-galactanase (EC 3.2.1.145, also known as galactan 1,3-beta-galactosidase) activity such as Clostridium thermocellum (Ct1,3Gal43A or CtGH43) and Phanerochaete chrysosporium 1,3Gal43A (Pc1, 3Gal43A), and arabinanase (EC 3.2.1.99) activity such as Ruminococcus champanellensis Ara43A. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
350099	GH43_CtGH43-like	3.16e-27	58	323	17	253	Glycosyl hydrolase family 43 protein such as Clostridium thermocellum exo-beta-1,3-galactanase CtGH43 and Ruminococcus champanellensis arabinanase Ara43A. This glycosyl hydrolase family 43 (GH43) subgroup includes characterized enzymes with exo-beta-1,3-galactanase (EC 3.2.1.145, also known as galactan 1,3-beta-galactosidase) activity such as Clostridium thermocellum (Ct1,3Gal43A or CtGH43) and Phanerochaete chrysosporium 1,3Gal43A (Pc1, 3Gal43A), and arabinanase (EC 3.2.1.99) activity such as Ruminococcus champanellensis Ara43A. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
350146	GH43_CtGH43-like	2.15e-22	73	323	38	267	Glycosyl hydrolase family 43 protein similar to Clostridium thermocellum exo-beta-1,3-galactanase CtGH43 and Ruminococcus champanellensis arabinanase Ara43A. This uncharacterized glycosyl hydrolase family 43 (GH43) subgroup belongs to a subgroup which includes characterized enzymes with exo-beta-1,3-galactanase (EC 3.2.1.145, also known as galactan 1,3-beta-galactosidase) activity such as Clostridium thermocellum (Ct1,3Gal43A or CtGH43) and Phanerochaete chrysosporium 1,3Gal43A (Pc1, 3Gal43A), and arabinanase (EC 3.2.1.99) activity such as Ruminococcus champanellensis Ara43A. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
350147	GH43_CtGH43-like	4.20e-19	73	289	39	221	Glycosyl hydrolase family 43 protein similar to Clostridium thermocellum exo-beta-1,3-galactanase CtGH43 and Ruminococcus champanellensis arabinanase Ara43A. This uncharacterized glycosyl hydrolase family 43 (GH43) subgroup belongs to a subgroup which includes characterized enzymes with exo-beta-1,3-galactanase (EC 3.2.1.145, also known as galactan 1,3-beta-galactosidase) activity such as Clostridium thermocellum (Ct1,3Gal43A or CtGH43) and Phanerochaete chrysosporium 1,3Gal43A (Pc1, 3Gal43A), and arabinanase (EC 3.2.1.99) activity such as Ruminococcus champanellensis Ara43A. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
350143	GH43_CtGH43-like	6.66e-18	63	323	15	245	Glycosyl hydrolase family 43 protein such as Clostridium thermocellum exo-beta-1,3-galactanase (Ct1,3Gal43A or CtGH43). This glycosyl hydrolase family 43 (GH43) subgroup includes characterized enzymes with exo-beta-1,3-galactanase (EC 3.2.1.145, also known as galactan 1,3-beta-galactosidase) activity such as Clostridium thermocellum exo-beta-1,3-galactanase (Ct1,3Gal43A or CtGH43), Streptomyces avermitilis MA-4680 = NBRC 14893 (Sa1,3Gal43A;SAV2109) (1,3Gal43A), and Ruminiclostridium thermocellum ATCC 27405 (Ct1,3Gal43A;CtGH43;Cthe_0661) (1,3Gal43A). It belongs to the GH43_CtGH43 subgroup of the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43_CtGH43 includes proteins such as Clostridium thermocellum exo-beta-1,3-galactanase (Ct1,3Gal43A or CtGH43) which is comprised of the GH43 domain, a CBM13 domain, and a dockerin domain, exhibits an unusual ability to hydrolyze beta-1,3-galactan in the presence of a beta-1,6 linked branch, and is missing an essential acidic residue suggesting a mechanism by which it bypasses beta-1,6 linked branches in the substrate. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS27085.1|GH43_37	0.0	1	560	1	560
QSZ30458.1|GH43_37	2.05e-99	11	560	4	563
ATZ54141.1|GH43_37	1.46e-98	12	560	10	560
CCD54286.1|GH43_37	9.27e-98	42	560	2	528
APA10103.1|GH43_37	1.69e-97	42	560	2	525

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EUG_A	4.14e-11	43	322	37	338	The GH43, Beta 1,3 Galactosidase, BT3683 with galactoimidazole [Bacteroides thetaiotaomicron],6EUH_A The GH43, Beta 1,3 Galactosidase, BT3683 with galactodeoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],6EUH_B The GH43, Beta 1,3 Galactosidase, BT3683 with galactodeoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],6EUH_C The GH43, Beta 1,3 Galactosidase, BT3683 with galactodeoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],6EUI_A The GH43, Beta 1,3 Galactosidase, BT3683 with galactose [Bacteroides thetaiotaomicron VPI-5482]
6EUF_A	1.15e-07	43	323	13	269	The GH43, Beta 1,3 Galactosidase, BT0265 [Bacteroides thetaiotaomicron VPI-5482],6EUF_B The GH43, Beta 1,3 Galactosidase, BT0265 [Bacteroides thetaiotaomicron VPI-5482],6EUF_C The GH43, Beta 1,3 Galactosidase, BT0265 [Bacteroides thetaiotaomicron VPI-5482],6EUF_D The GH43, Beta 1,3 Galactosidase, BT0265 [Bacteroides thetaiotaomicron VPI-5482],6EUJ_A The GH43, Beta 1,3 Galactosidase, BT0265 [Bacteroides thetaiotaomicron VPI-5482],6EUJ_B The GH43, Beta 1,3 Galactosidase, BT0265 [Bacteroides thetaiotaomicron VPI-5482],6EUJ_C The GH43, Beta 1,3 Galactosidase, BT0265 [Bacteroides thetaiotaomicron VPI-5482],6EUJ_D The GH43, Beta 1,3 Galactosidase, BT0265 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ASPVEDRAFT_75048-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999740	CS pos: 18-19. Pr: 0.9802

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_75048-t33_1-p1.