CAZyme Information: ASPVEDRAFT_72317-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_72317-t33_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	KV878129|CGC4	42941.31	4.2246

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878129:1126784-1128083(+)

Full Sequence      

MKSILLLAAAAPLALAWLPDGKVRGVNLGSHFIFEPWISNSAWSDLGCSGQNSEFDCVLK
LGQDAADKAFASHWGSWTTQDDISQMREYGLNTVRIPVGYWIKEDLVDKDSEHFPRGGLK
YLEDVCGWASDAGMYIIMDFHGLPGAQEAEQPFTGQYADTPGFYNDYQYGRALEWLEWMT
KTVHQNDKFRNVGMIELVNEPVQDAGQASSMRSSYYPDAFKRIRDTETSLSVSSDSYLHV
QMMNEKWGSGDPTESLSDTSHAAYDDHRYLKWDSSVEVNKDSYISASCSDDRGGNTPTIV
GEWSLSVPDDVEGSSDWDPESNTDFYAKWFAAQVIAYEKQLGWVFWTWKAELDDYRWSYK
DAVDAGVIPKDLDSIHDNSPC

Enzyme Prediction     

EC	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	62	360	2e-146	0.9966666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.51e-22	22	370	17	383	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.01e-11	71	350	13	270	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24206.1|GH5_15	2.28e-268	1	381	1	409
EAA59985.1|GH5_15|3.2.1.75	5.05e-226	1	381	1	409
ABF50867.1|GH5_15|3.2.1.75	5.05e-226	1	381	1	409
BCS30770.1|GH5_15	1.78e-214	12	381	26	398
BCR89699.1|GH5_15	3.42e-196	7	381	9	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	6.95e-36	16	370	1	380	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	2.02e-35	16	370	6	385	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	2.57e-35	16	370	1	380	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PF0_A	2.85e-35	16	370	7	386	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PB1_A	2.85e-35	16	370	7	386	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	8.98e-227	1	381	1	409	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|A1DGM6|EXGB_NEOFI	1.87e-205	1	375	2	393	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	2.77e-201	9	381	13	403	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	2.17e-196	8	360	9	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|Q4X1N4|EXGB_ASPFU	2.52e-195	8	360	9	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000252	0.999726	CS pos: 16-17. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_72317-t33_1-p1.