CAZyme Information: ASPVEDRAFT_720309-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_720309-t33_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	KV878130|CGC5	41208.70	4.6042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878130:611171-612322(-)

Full Sequence      

MLTFRKALIIAAVLISLILFLRPSPSSSETPVAVSPEAVAEDISHETKEQSSSQLPSQDA
GSQQQPLKQPPPPNASLAERLRYHFPYSLETKFPAYIWQTWKYTPASVWFDRDLRKQEAS
WTDLNPNFVHQVIPDDTVRYLIKYLYGSVPEVLEAFDALPLAVLKADFFRYLVLLARGGV
YSDIDTTALKPVLDWLPSTLDLSTVGFVVGIEADPDRPDWADWYSRRVQFCQWTIQSKPG
HPILIDIVSYITQETLRMKNAGILKKGKMDKTIVEFTGPAAWTDAVFRYFNDPEYFSIEP
GSTHNLTYEDFTNQVEYQKVGDVVVLPITSFSPGVNQMNAQGTDDPMAFVEHDFEGTWKT
DPSL

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	115	198	7.4e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.33e-40	79	361	68	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.29e-16	120	199	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29442.1|GT32	3.24e-248	1	364	1	364
EAA60758.1|GT32	5.76e-207	1	364	1	362
CBV36935.1|GT32	4.72e-196	1	364	1	359
QRD84625.1|GT32	1.64e-190	1	364	1	363
UDD58159.1|GT32	4.70e-190	1	364	1	363

PDB Hits     

ASPVEDRAFT_720309-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	3.45e-91	72	361	78	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.09e-77	83	361	132	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	5.00e-69	65	364	103	393	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.80e-65	76	361	79	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q5UQW4|YL373_MIMIV	3.88e-06	113	196	20	101	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.496032	0.503959	CS pos: 27-28. Pr: 0.4444

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_720309-t33_1-p1.