CAZyme Information: ASPVEDRAFT_71789-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_71789-t33_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
867	KV878128|CGC18	94113.44	7.6074

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878128:2059970-2062865(-)

Full Sequence      

MAAKDQPGVFELPAEPVMVLPSLPAADIGPSGVNLNDDGRVSIDWDSRFVRAFSKLYSGP
FLGRPTTPPPDYSELPPEPADATIQIPGNPPPYPESVVEIKKSWKVQLNIVVQVVGSRGD
VQPFIALGNELQRYGHRVRLATHDVFESFVRDSGLEFFPIGGDPVDLMAYMVKNPGLVPS
MERLWAGDIQRKRIMFREMLDGCWRSCIEPDMHTQIPFVADAIIANPPSFAHIHCAQALS
IPVHLMFTMPWSSTKAFPHPLANMRGGDGDESLKNYVSYGVVDWLTWQGLGDVVNQWRKD
LDLEEVATFEGPHLAEILQVPFTYCWSPALVPKPRDWPSYIDVCGFFFRDTPKYDPPADL
TAFLASGPPPVYIGFGSIVLEDPERINAIITNAVDAVGARAIVSKGWSNLGGAHHSNIYS
IGDCPHEWLFDHVAAVVHHGGAGTTACGLRKAKPTLIVPFFGDQPFWGAMVAAAGAGPTP
IPHKQLTVDALAAGIRYCLSEHAAEAASAIAHKMSSESGIRAAVSSFHRNLPLERLQCDL
YPSQPAVWSVSVPKSRQKVKLSKFAAETLVADGMIDKKNLTIHPINPILIENRRWDPITG
GASALIRTTTDLTGSLLGTFYKPVQEYQDYHEHRKDQRVSSRSSQVSHRPTSSASFGSTS
KDLEKEKVAAGAGTESSNTTPRSNQGGGRLVARVAGASAKSLGSFVPTALKGMTVDIPLA
LTEGLRNVPRYHGEEPRDHGPVTDIKSGFAVAGNGFVWGMAEAVSDIVVKPYQGMQQDGT
KGAVKGIGKGMSNMVSKAGCAMFGVLIYPSAGIAKSLHASIHSRTRKLIVKSRCGEGVWM
LEGGQYTVTDRDQVVRGFREILNRKKG

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	134	526	1.9e-54	0.9581151832460733

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.21e-63	108	467	1	342	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.59e-31	110	467	4	335	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	2.67e-25	110	258	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	5.63e-04	119	465	7	324	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86527.1|GT1	0.0	1	866	1	867
BCR84763.1|GT1	0.0	9	845	10	854
BCR98772.1|GT1	0.0	1	866	1	870
BCS11094.1|GT1	0.0	1	866	1	870
CAP93840.1|GT1	0.0	8	844	9	850

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.26e-73	92	535	8	443	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	3.79e-73	92	535	28	463	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.84e-29	108	523	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	2.37e-25	108	511	1	362	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	5.55e-23	108	523	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	7.25e-128	93	534	142	577	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	3.19e-125	95	532	180	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q4WID6|ATG26_ASPFU	7.11e-74	96	531	892	1319	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2
sp|A1CYS1|ATG26_NEOFI	7.31e-74	96	531	901	1328	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1
sp|A1CFB3|ATG26_ASPCL	2.35e-73	96	531	898	1325	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_71789-t33_1-p1.