CAZyme Information: ASPVEDRAFT_713030-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_713030-t33_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
563		62500.75	4.9497

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878130:145666-147405(-)

Full Sequence      

MGHGSQCRTPRVSPIAMARLPLLIGITCLAVSALSAPAISARKNLPWADLAISAPPNGRY
LYRTATGDPFLWIADTNWELFHRLNKTDADLYLADRAAKGFTVVQAVLLSKYNVTTIPNF
YGDLAIDNSDPTQLNENYFSFVDWVTARAAEYGILICFVPVWGRYVNGGWYGTIGPRLFN
EENAAVFGKYLGKRYPGIPKMMGGDANGFWANNVPQARQAWRDSEDDSADPTSFLDPIED
TRGIWAAMMKGFKEEEAKVGYDAFVTFQPTSPWISDPPTPLPYGHNYINGTLGTLSMDAV
QSGHENPDPNGIDANFTVLTPWDSTKNYENIIQMRSQFPGPVMDVENHYEGAHDSFDTDK
PLWNASHVRHGFYPAVFSGACGITYGSLPVQQSYENRSLVASPEHWQVPQLGLSEDASWH
EAIHWPGAKQTGYVGKLFTSLSREEFNGLRPARGYIRSPEGKENILSYESNRYIAGMITK
GHYWVYTGYGDAFNLDLAGISEDWGYPADQLQVEWLDPRTSHTHKVDSGILETSKDEATF
TPPSSGGVDHDWVLVIKSTSNSC

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_713030-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	56	554	6.7e-74	0.9830097087378641

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	1.05e-109	57	441	1	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	8.69e-10	467	556	11	91	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	1.05e-201	45	562	26	539
KAF3763706.1|GH140	2.00e-181	24	556	4	535
KAE8332162.1|GH140	1.20e-70	49	558	26	509
KAE8313632.1|GH140	4.82e-69	48	558	25	509
KAB8225539.1|GH140	4.82e-69	48	558	25	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	1.82e-25	42	536	8	450	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	4.94e-23	42	536	8	450	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ASPVEDRAFT_713030-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.109983	0.889981	CS pos: 35-36. Pr: 0.7173

TMHMM  Annotations     

Start	End
20	39