CAZyme Information: ASPVEDRAFT_664468-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_664468-t33_1-p1
• CAZy Family: GH93
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
279		30763.04	9.1763

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878129:569299-570210(-)

Full Sequence      

MQPVNPPTLRLVCRGRLSSPLHSVARTWPRCLPLLSPRMARHAFSDSRTENSKQESSHRI
PLRLMPLGGSITNGIGSSSGNGYRKKLNDMLVARGHQTVMVGSRRSGTMANNDNEGWRGY
RIDQIHEKAMKSAARHLPNLFTVNAGPNDCLQDYEIQTVGLRLEALLEELWRIASPSATV
VLSTLIVAADEGINSRILRVNEQIRDLVERKGADNKRIVLADLYGPRGPRVGDLVDDGIH
PGDEGYVKMAEIWADSIEQAARDGLLQPPQDVPNRGGCI

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_664468-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	62	257	4.5e-52	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.63e-32	62	257	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	2.54e-14	67	246	2	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	2.41e-12	67	255	4	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238870	SGNH_hydrolase_like_1	1.72e-10	67	256	5	185	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.
395531	Lipase_GDSL	2.86e-09	64	253	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23966.1|CE3	1.38e-149	1	275	1	277
QGI68641.1|CE3	3.11e-78	47	265	37	253
QPG99528.1|CE3	5.51e-74	59	273	42	255
QKD62224.1|CE3	8.61e-73	65	267	1	201
UNI18483.1|CE0	5.16e-69	62	273	22	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	1.22e-14	62	253	6	191	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

ASPVEDRAFT_664468-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_664468-t33_1-p1.