CAZyme Information: ASPVEDRAFT_65906-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_65906-t33_1-p1
• CAZy Family: GH92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757	KV878137|CGC3	83414.94	6.1678

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878137:658351-660669(+)

Full Sequence      

MRSLNLLLWALSTGAFAAQNPLNLGKGFALAVDDTANRVSITQNGRRIWETVPGKSFVSA
SGGEDIVTAANGNFKIEEVDQNKCTGQEITNVEQRSWNGTVNGHAAVIQGKLTDCGDAIV
PFSVAFWVPSQSPDRIAFNAQVNGGSSSDAATKLFLTYASSPSEDFYGLGAQASFASLKN
QSVPIFSREQGVGRGDQPTTELNSEDGFFAGGDHFTTYSAIPQYISSHSRVFSLTEESTA
YTTFDFTEANAVTVRYDAPSVDGYLMQADSMLDGITMVTDYTGRMPELPQWVDSGAVVGI
QGGQDKVNKVVERGLSQGCPIAGVWLQDWSGTHEQSVSYMSLNVSRLWWNWENDANLYPT
WNDFVQSLRDRHDIRTLSYINPFLANVSTKSDGYRSHLYLEATKGGYMIQNATTNGTSVI
SSGPGLDAGIIDLTNSAGRSWFRNMMLDQVWNANISGFMTDFGEYTPVYPDTQFADKSID
PFFYHNAYPREWAALHHWIGKSVPQFKDSILFHRSSSMSANRYQNLYWAGDQAINWGVND
GIKSSVTVMAHMGLSGYAHGHTEIGGYTTTWNSNGVVNRTAELLGRWGELAAVSSSVFRS
HEGNVPQVNAQSYTNSSTYAYFAYNARMFASLGKYRRAILDTESKKLGWPVLRMPVIYYP
DDPKAKAISYQSFFLGADLYVAPVLDPGRMSVEVYFPGQGQMYTHVWSGKVYRGGQTARV
GAPYGKPAVFVVGRPQHDLLHDFMQFVKKENGTAIRV

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_65906-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	264	731	1e-67	0.9812646370023419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	9.12e-166	152	740	70	627	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	1.20e-149	283	626	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	5.24e-58	153	731	142	664	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	6.47e-42	264	731	1	436	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	2.61e-26	350	698	49	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28035.1|GH31	0.0	1	757	1	758
CAP79722.1|GH31	0.0	1	755	1	756
QQK47473.1|GH31	0.0	1	757	1	758
QMW44330.1|GH31	0.0	8	757	8	770
QMW32300.1|GH31	0.0	18	757	22	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AED_A	8.57e-87	153	730	116	661	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5OHY_A	2.35e-86	27	751	9	667	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5AEE_A	4.49e-86	153	730	116	661	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
5OHS_A	1.23e-85	27	751	9	667	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
6PNR_A	7.26e-83	149	730	97	647	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	3.68e-86	153	730	116	661	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|Q9F234|AGL2_BACTQ	9.66e-18	164	731	147	668	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|Q8BHN3|GANAB_MOUSE	3.19e-09	528	733	615	806	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|Q43763|AGLU_HORVU	4.08e-09	514	733	518	722	Alpha-glucosidase OS=Hordeum vulgare OX=4513 PE=2 SV=1
sp|P79403|GANAB_PIG	5.52e-09	528	733	615	806	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000374	0.999598	CS pos: 17-18. Pr: 0.9751

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_65906-t33_1-p1.