CAZyme Information: ASPVEDRAFT_65632-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_65632-t33_1-p1
• CAZy Family: GH88
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
888	KV878136|CGC6	98152.27	4.9974

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878136:638933-641626(-)

Full Sequence      

MRLKYTVHHASQLLLCSLLPTRLHSGWKFSHFPETPDGITYSIRPDNENENLVELRDWIL
PGANPFIADPAKHYEQPDSPPDIDIPYVNNDFDDANWTSVTVPHDWAIAEDFVSDDEVSG
DMGRLPVRGVGWYRYSDLYFPASEQNANHSIFLDVEGVMAYSMVWLNGHLVGGWPYGYAS
YRLDLTPYVRYGEENVLAVRAENPQTRQFSRWYPGAGIYRDVWITKVAKTHVALYGTDIS
TRDVSRDRATVDLAVTVDNQNKWDAGVRVVTNVHEYVSGRVGRRVAAFSNQTLHLSPGKS
SSINSSVTIKNPSLWGPPPTQKPNMYIAITQLYTRNQLLDQYSTPFGIRNLAYSPTHGLI
VNNERIPIQGVNLHHDLGALGAAYNHRAATRQLEILRELGANAIRTAHNPPAPSLLALAD
EMGFLVLDEIFDVWEAAKVDSDFSLIFTDWAEADLRSFIRRDRNHPSIVIWSVGNEVPEQ
VDNQTSAGKIMASLRSITHQEDASSTPPRPVTASLNRPVSNSTMAGNMDAISLNYQGEGV
RWGPAYTHLTGGSRTSPQYDTFHAAHPYAAPILGSEVAWSLSTRGSFFFPVSPYISAPVN
DTNGGGNSSIYEVSAYEVYSSDAGSTPDRVFLTQDTHPFVAGGFVWAGFDYLGEPYPYDA
RSAYSGILDLAGFKKERFWVYQARWREDLAMAKIVPHWNWPDRVGEITPVHVFSSGDEAV
LYINGAQQGPKKRKGEGEYRFRWDEVVYQPGEVRVVVYKEGKVWAEDVVATTGEPAALRL
SVDRSVIAADGEDLAFVTVEVVDSDGNVVPTADDEVHFSIANSSGAGVVVATDNGFPADF
TSFASSSRKVFHGLALGVVRAEEGVSGDFVVEVSSDGLRAAEITITAR

Enzyme Prediction     

EC	3.2.1.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	26	755	2.8e-101	0.6462765957446809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	3.20e-55	95	498	40	428	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
408349	Glyco_hydro2_C5	1.35e-40	778	884	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
236657	PRK10150	7.36e-37	147	476	80	417	beta-D-glucuronidase; Provisional
236673	ebgA	6.39e-29	72	476	51	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
236548	lacZ	3.19e-24	78	476	65	462	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28623.1|GH2	0.0	1	887	1	893
EAA58410.1|GH2	0.0	23	887	42	886
QKD56624.1|GH2	0.0	22	885	36	889
BCS19873.1|GH2	0.0	22	885	41	896
CBX94573.1|GH2	0.0	23	888	46	903

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	2.01e-165	92	885	49	818	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	6.76e-140	92	885	28	799	Chain A, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	8.91e-139	89	885	31	805	Chain A, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6QUB_B	1.12e-127	92	885	31	851	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]
6QUB_A	2.23e-127	92	885	54	874	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum],6QUC_A Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUC_B Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUD_A 2-deoxy-galactose reaction intermediate of a Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7LXS9|BGH2A_BACO1	3.68e-163	92	887	66	848	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
sp|T2KM09|PLH16_FORAG	1.95e-86	73	861	56	795	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|T2KN75|PLH17_FORAG	8.15e-52	92	821	50	735	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
sp|T2KPJ7|PLH8_FORAG	4.12e-43	88	733	70	677	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	1.84e-41	91	820	26	687	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.976033	0.023985

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_65632-t33_1-p1.