CAZyme Information: ASPVEDRAFT_65239-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_65239-t33_1-p1
• CAZy Family: PL4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561		63046.09	7.6446

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878135:354684-356522(+)

Full Sequence      

MLTAIWNKVFNLAGCILVAIIYAYLLKYSGKLLTFDTLVTIFLAELCRWTNQRRRHISTA
RLQAGASLDIVEKGEKQTVSPGMIAAVVGYREDPFLFKQALESYLQAQDCRFLLVSIDGD
TDEDEEMIDVFREVCKDNAAFIHLDVPLAQIALQLERESEGRLSQTDIITRCCSIARGAL
DEKGVNVSGPGAITRLCVSQPHMHKKGVMFTSFIISLVVSDMLGIEFVWTSDSDSMVLPD
TLTRTMETFSDGTIGGASTALYIHNRNETTITKLGSGVYLNELYLARSFTGSAAANDCQS
GPSAAFRISAIRDELLGWYKQTVLGHWMVTNEDRHLTTRLLLKGWRVVFASDVLTATETP
TTLRRWLLQQVRWARAVHIESLHRPAVYLVQSPILFLASLRRQTAAFLVPTTILIYLFTG
ILVFDGIPLQDLVRRQTIIFFYLLLRNPYRPSLNTWLWFLPAAAFYNIPLPAIEIWSFLT
VFHDSWGTTMRSQKEVSRHSRWAVRFWEVGFFITWMAVVGGTLARYLASSWMLSPFPLGA
CIFAGAASAAGLSSLWMVLSE

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_65239-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	5.05e-23	197	376	57	231	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
224136	BcsA	1.59e-20	226	538	139	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404400	Glyco_transf_21	2.13e-12	226	375	33	174	Glycosyl transferase family 21. This is a family of ceramide beta-glucosyltransferases - EC:2.4.1.80.
133043	CESA_CelA_like	1.01e-11	226	375	86	228	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
133059	CESA_CaSu_A2	2.50e-11	226	375	89	230	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR94980.1|GT2	2.45e-241	2	561	20	578
BCS07553.1|GT2	2.45e-241	2	561	20	578
BCS30637.1|GT2	7.01e-229	4	371	4	371
CAK96559.1|GT2	1.70e-192	2	561	20	519
QRD03251.1|GT2	9.20e-178	6	561	44	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	1.59e-21	87	376	89	346	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	6.63e-21	87	376	89	346	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O57426|HYAS3_XENLA	1.39e-21	83	383	83	357	Hyaluronan synthase 3 OS=Xenopus laevis OX=8355 GN=has3 PE=2 SV=2
sp|O00219|HYAS3_HUMAN	1.02e-20	87	383	91	367	Hyaluronan synthase 3 OS=Homo sapiens OX=9606 GN=HAS3 PE=1 SV=3
sp|O08650|HYAS3_MOUSE	1.34e-19	87	383	92	368	Hyaluronan synthase 3 OS=Mus musculus OX=10090 GN=Has3 PE=1 SV=2
sp|Q61647|HYAS1_MOUSE	1.96e-19	61	383	78	394	Hyaluronan synthase 1 OS=Mus musculus OX=10090 GN=Has1 PE=1 SV=1
sp|P70312|HYAS2_MOUSE	2.36e-19	87	383	89	364	Hyaluronan synthase 2 OS=Mus musculus OX=10090 GN=Has2 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000000

TMHMM  Annotations     

Start	End
9	26
405	427
456	478
507	529
536	558