CAZyme Information: ASPVEDRAFT_58591-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_58591-t33_1-p1
• CAZy Family: GH75
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
161	KV878125|CGC9	17621.11	4.1128

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878125:2433878-2434606(-)

Full Sequence      

MQRRADDRGNYTVSGLGARKQEVTAAGGTSQDLAIAMLETLNAGDGKTGDATNFGIFKQN
WMMLRTSTSQFEGLTEGDVDQGAVLNSDLAADITDRHESQDHYGYTTWCAGHRNGASGLS
NPDTEDIATYKSAIEWIQQQIDSDEVYLTDDTRFWVDVTAI

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_58591-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH134	9	161	3e-73	0.9937106918238994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381622	mannanase_GH134	2.92e-82	6	161	1	162	glycosyl hydrolase family 134 inverting endo-beta-1,4-mannanase. glycosyl hydrolase family 134 beta-mannanase (E.C. 3.2.1.78) differs from other mannanases in as it has a hen egg white lysozyme fold and cleaves beta-1,4-mannans with inversion of sterochemistry. Beta-mannosidases are enzymes involved in seed germination and the degradation of the hemicellulose fraction of soft- and hardwoods.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21530.1|GH134	1.36e-97	1	161	20	187
EAU35362.1|GH134	2.80e-78	3	161	21	185
CRG85396.1|GH134	5.73e-76	6	161	26	187
EAW08561.1|GH134	6.03e-72	5	161	19	181
CAP81003.1|GH134	6.30e-72	4	161	30	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XTJ_A	1.83e-65	7	161	2	162	Mannanase(RmMan134A) [Rhizopus microsporus],5XTJ_B Mannanase(RmMan134A) [Rhizopus microsporus],5XTT_A Crystal structure of RmMan134A-M3 complex [Rhizopus microsporus],5XTT_B Crystal structure of RmMan134A-M3 complex [Rhizopus microsporus],5XU5_A Complex structure of RmMan134A-M4 [Rhizopus microsporus],5XU5_B Complex structure of RmMan134A-M4 [Rhizopus microsporus],5XUG_A Complex structure(RmMan134A-M5). [Rhizopus microsporus],5XUG_B Complex structure(RmMan134A-M5). [Rhizopus microsporus],5XUL_A Complex structure (RmMan134A-M6). [Rhizopus microsporus],5XUL_B Complex structure (RmMan134A-M6). [Rhizopus microsporus]
5XXA_A	1.23e-63	7	161	2	162	beta-1,4-mannanase-SeMet-RmMan134A [Rhizopus microsporus],5XXA_B beta-1,4-mannanase-SeMet-RmMan134A [Rhizopus microsporus]
5JU9_A	8.56e-63	9	161	10	168	Structure of a beta-1,4-mannanase, SsGH134, in complex with Man3. [Streptomyces sp. NRRL B-24361]
5JTS_A	1.01e-62	9	161	15	173	Structure of a beta-1,4-mannanase, SsGH134. [Streptomyces sp.]
5JUG_A	2.45e-62	9	161	10	168	Structure of an inactive (E45Q) variant of a beta-1,4-mannanase, SsGH134, in complex with Man5 [Streptomyces sp. NRRL B-16215]

Swiss-Prot Hits     

ASPVEDRAFT_58591-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_58591-t33_1-p1.