CAZyme Information: ASPVEDRAFT_57618-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_57618-t33_1-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		43726.25	3.8495

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878140:260065-261326(+)

Full Sequence      

MKLLYLLSAANTPFSVSGRWILDSAGSPVTFAGVNWPGAGEAMVPEGLQYASIESTVSKI
KSLGMNVIRLTFPIELVDNILDTGDITVQDSFINALGSENGTAVFNQITASNPQITNTTT
RLAVYDMVAEECNAQGIYVHLDNHISKAMWCCSNDDGNAWFGDTYFNVENWKRGLEYMAS
HASSWPSFTGIGLRNELREPSTENPDYPYNWETWYTEMTSAAEAVNAANPDALIYLSGLN
YDTTLSPIPTGEDLGSGTKFSLSDFAYAEKLVLELHNYDTTATSCDDLSGSLWNGGFNAQ
DTNDTSIVNVMPVVLTEFGFAQDQSTWQSVYASCIREWIPEQQAGWMVWTISGSYYIREG
TQDSDDTWGILDHTWSDWRNQEAIEQGLQGMVDASI

Enzyme Prediction     

EC	3.2.1.164:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	21	352	1e-162	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.14e-04	22	319	1	237	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23457.1|GH5_16	1.95e-274	9	396	17	404
EAA61999.1|GH5_16	9.13e-236	8	396	21	410
CAK38078.1|GH5_16|3.2.1.164	2.56e-187	8	396	20	411
BCR93024.1|GH5_16	8.95e-187	8	396	20	411
BCS05683.1|GH5_16	8.95e-187	8	396	20	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	3.30e-17	17	396	9	354	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	2.00e-16	17	396	9	354	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C0HLA0|GH5FP_CHAOB	5.58e-55	3	386	17	390	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P54583|GUN1_ACIC1	3.03e-16	8	396	41	395	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P23548|GUN_PAEPO	8.70e-08	14	378	39	370	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.754457	0.245571

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_57618-t33_1-p1.