CAZyme Information: ASPVEDRAFT_56804-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_56804-t33_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
709		79437.21	5.7589

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878137:262285-264414(+)

Full Sequence      

MSAQIISVESKCLRVSVRIDQQGAACLDAVIPTRSAQPDSVSKYFPDHHAPLVEVRLAGE
GTEKHKSSKALLGTYVGPRLRYQTHDIHTGEGAKTLNVSLADGSLTVVSHLTVYNTTPVV
RATASVRNNSDQDVVVTQITSLVLGGVTTGSSKWWADYTLSVPTNSWFREAQWIEHDLPS
IGVDDYGVYGRPENHYASLGHYAVSNRGTFSTEGHLPMGLLKRRDNAETWLWQVENNGSW
RWEIGDWKDSVYLAAGGPVETDHDWRQRLGPGEEFTTVPVALCHVFDDYEKAFAGLTQYR
RVIRRKHSDNEHLPIIFNDYMNCLMGDPTDEKILALVDPVVKAGAEYFVIDCGWYADDAG
WWDDVGEWEPSKKRFSKGLKHLLGQLREKGLTPGLWIEPEVIGVRSVVADELPYETFFQR
DGQRVVEKGRYQLDFRHPAVRDRMHGIIGRLVNDFGVGYFKFDYNIEVTQGTDIDCSSPG
SGQLGHNRAYLRWVNELYDRFPDLVIENCSSGAQRMDYAMLATHSLQSTSDQQDSDRYAA
ISAALPTAVTPEQGATWAYPQPEWDDETNAMTVVNSLLGRIHLSGRLDILQPHQFDIIKE
GMDVYRSIRADLTTATAFWPLGLPHWHDDWLALGMAAASGGRYYISVWRRGGADTVELSV
PQLKGREVKAGLLYPASFNAESEWKATDGVLRVKVPSELCARLFRLTIV

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_56804-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	77	659	4.9e-93	0.8299418604651163

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269892	GH36	2.11e-81	313	606	2	298	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
307952	Melibiase	5.27e-32	275	560	2	279	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
225882	GalA	6.18e-24	78	535	82	509	Alpha-galactosidase [Carbohydrate transport and metabolism].
269893	GH27	1.43e-06	317	395	5	84	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
407116	Glyco_hydro_36N	1.44e-06	78	178	72	181	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28301.1|GH36	0.0	1	708	1	707
EAA67014.1|GH36	0.0	1	708	22	731
QMW46905.1|GH36	0.0	6	707	64	772
BAE64621.1|GH36	0.0	6	707	7	715
QRD91154.1|GH36	0.0	6	707	64	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	2.34e-30	91	517	132	538	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	3.11e-30	91	517	132	538	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
4FNQ_A	4.09e-24	80	609	102	629	Crystal structure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	5.41e-24	80	535	102	552	Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNT_A	1.66e-23	80	609	102	629	Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G1UB44|MELA_LACAC	1.20e-29	91	517	132	538	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
sp|P43467|AGAL1_PEDPE	9.15e-24	93	520	132	539	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
sp|Q9ALJ4|AGAA_GEOSE	2.78e-23	80	535	102	552	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
sp|Q9UUZ4|AGALC_ASPNG	1.24e-19	38	580	89	607	Alpha-galactosidase C OS=Aspergillus niger OX=5061 GN=aglC PE=1 SV=1
sp|P27756|AGAL_STRMU	6.33e-19	177	560	178	560	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000005	0.000057

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_56804-t33_1-p1.