CAZyme Information: ASPVEDRAFT_56300-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_56300-t33_1-p1
• CAZy Family: GH62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658	KV878135|CGC6	71078.10	4.2646

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878135:713727-715936(-)

Full Sequence      

MANTAFTSLLFASTALGSSSLKPRLQDGLARTPQMGWNTYNQYNCFPSEEAVKLNAEALV
ATGLADLGYRYVTIDCGWTVADRLPDGSLTWNETLFPDGFPAMGRYLHDLGLLFGVYQDS
GILLCGSPPNNTGSLYHEDIDARTFAEWEVDSLKYDNCYSDAATNYPNVNYQPSTSPQPR
FANMSRYLQAQDRPILYQVCEWGISFPAAWAPEIGHSWRIGNDITPHWRSIFRTLNQAVP
QTDYAGPGQWPDPDMLLVGLEDVLTIPEEQTHFSLWGVLKAPLTIGAKVDGMREGSLDIL
RNEDVIAFNQDGLGVSAALRRRWSDQGYEVWSGPLEGGRTVVAVINWRGEEREITLDLPD
VGLQFAGGLRDIWAGESAEDVKTKYTAVVAAHGTMLVELSETLPAGEYPSDIFAATNGGA
TTFGAVYGVTSSPNYGLKVTLAQPSQGANITITTSSSNAPVSVSVPVGSSSITTQISLAA
SSNNTVTIHNAPAISSIQVTPPNSTYYTGTKDFTLSGSADTFTCPDDFCIPTGSKITNLG
TNSSATAQIPSMVQGSKYIEIDYINNEVAFDSAWEWGSNSRNLTIRVNDAEPVRLEVPLS
GRHSELFGPGLGWWDSARLGVLTGGWKVGLNEVVLGNENGEGGFTGFAPDVVGINVYN

Enzyme Prediction     

EC	3.2.1.22:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	133	377	3.7e-69	0.9737991266375546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269893	GH27	2.43e-112	33	311	1	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
166449	PLN02808	1.21e-98	4	400	3	384	alpha-galactosidase
177874	PLN02229	8.98e-97	24	394	54	412	alpha-galactosidase
178295	PLN02692	6.66e-92	25	396	48	405	alpha-galactosidase
374582	Melibiase_2	1.58e-63	32	311	1	284	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS30458.1|CBM35|GH27	0.0	6	657	8	660
ABF50881.1|CBM35|GH27|3.2.1.22	0.0	5	658	3	659
EAA61404.1|CBM35|GH27|3.2.1.22	0.0	5	658	3	640
UDD59118.1|CBM35|GH27	2.17e-313	16	656	15	656
QMW29010.1|CBM35|GH27	6.20e-313	15	656	14	656

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UAS_A	3.22e-84	26	400	2	360	Chain A, alpha-galactosidase [Oryza sativa]
6F4C_B	3.14e-80	25	400	1	361	Nicotiana benthamiana alpha-galactosidase [Nicotiana benthamiana]
3A5V_A	1.11e-67	27	401	3	392	Crystal structure of alpha-galactosidase I from Mortierella vinacea [Umbelopsis vinacea]
4OGZ_A	8.46e-64	10	390	75	463	Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343],4OGZ_B Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343]
3LRK_A	1.36e-63	27	361	24	376	Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae],3LRL_A Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AX28|AGALD_EMENI	0.0	5	658	3	659	Alpha-galactosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglD PE=1 SV=2
sp|Q2UI87|AGALD_ASPOR	1.92e-314	15	656	14	656	Probable alpha-galactosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aglD PE=3 SV=2
sp|B8N7Z0|AGALD_ASPFN	1.30e-309	15	656	14	654	Probable alpha-galactosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=aglD PE=3 SV=1
sp|A2R2S6|AGALD_ASPNC	1.76e-301	13	656	12	658	Probable alpha-galactosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=aglD PE=3 SV=2
sp|A1D9S3|AGALD_NEOFI	8.25e-297	9	656	7	646	Probable alpha-galactosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=aglD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.622710	0.377302

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_56300-t33_1-p1.