CAZyme Information: ASPVEDRAFT_55993-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_55993-t33_1-p1
• CAZy Family: GH55
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	KV878134|CGC13	49183.39	3.7881

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878134:1003314-1004815(-)

Full Sequence      

MYQRALLFSAALLSVSRAQQAGTLQEEVHPPLTWQRCEASGTCTEVSGSVVLDSNWRWTH
GVDDSTNCYTGNEWDATLCPDNESCATACAVDGADYEATYGITSTGDALTLKFVTGENVG
SRVYLMEDDETYQTFDLLNNEFTFDVDVSNLPCGLNGALYFTSMDADGGLAKYENNKAGA
KYGTGYCDSQCPRDIKFINGLANVEGWEPSDSDANAGVGGMGSCCPEMDIWEANSISTAY
TPHPCDDIEQTMCEGDACGGTYSSERYAGTCDPDGCDFNSYRMGNESFYGPGGLVDTASK
ITVVTQFIADGGSLSEIKRFYVQDGNVIANSASNVDGVEGNSITTEFCTAQKTAFGDEDI
FAEHGGLTGMGDASSAMVLILSIWDDHYASMMWLDSSYPEDADPSTPGVARGTCENGAGD
PTNVESEHGDASVTFSNIKFGPIGSTFDSAGTGSGSNSTARRF

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	20	447	1.9e-190	0.9951807228915662

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395677	Glyco_hydro_7	0.0	21	446	1	434	Glycosyl hydrolase family 7.
153432	GH7_CBH_EG	0.0	27	441	2	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24847.1|GH7	0.0	1	463	1	464
EAA62357.1|GH7	2.94e-306	1	447	1	446
ABF50871.1|GH7	2.94e-306	1	447	1	446
AAM54069.1|GH7	6.92e-305	1	447	1	446
BAE61042.1|GH7	1.20e-275	1	448	1	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1Q9H_A	2.08e-233	20	447	2	434	Chain A, cellobiohydrolase I catalytic domain [Rasamsonia emersonii],3PFJ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFX_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFZ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PL3_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii]
4V1Z_A	8.93e-231	20	449	2	439	The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus [Aspergillus fumigatus],4V20_A The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus, disaccharide complex [Aspergillus fumigatus]
4ZZT_A	8.91e-214	20	447	2	435	Geotrichum candidum Cel7A structure complex with thio-linked cellotriose at 1.56A [Geotrichum candidum],4ZZU_A Geotrichum candidum Cel7A structure complex with thio-linked cellotetraose at 1.4A [Geotrichum candidum],4ZZV_A Geotrichum candidum Cel7A apo structure at 1.4A [Geotrichum candidum],4ZZW_A Geotrichum candidum Cel7A structure complex with cellobiose at 1.5A [Geotrichum candidum],5AMP_A Geotrichum candidum Cel7A apo structure at 2.1A [Geotrichum candidum]
4CSI_A	4.11e-210	20	446	2	433	Chain A, CELLULASE [[Humicola] grisea var. thermoidea],4CSI_B Chain B, CELLULASE [[Humicola] grisea var. thermoidea]
5W11_A	3.29e-207	21	446	3	433	Biochemical and structural insights into the catalytic mechanism of thermostable cellobiohydrolase Cel7A from industrially relevant fungus Myceliophthora thermophila [Thermothelomyces thermophilus],5W11_B Biochemical and structural insights into the catalytic mechanism of thermostable cellobiohydrolase Cel7A from industrially relevant fungus Myceliophthora thermophila [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B2Q4|CBHA_EMENI	5.23e-307	1	447	1	446	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cbhA PE=2 SV=1
sp|Q0CRF7|CBHA_ASPTN	8.46e-278	1	452	1	452	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhA PE=3 SV=1
sp|B8N7G5|CBHA_ASPFN	2.14e-276	1	448	1	452	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=cbhA PE=3 SV=1
sp|Q2UBM3|CBHA_ASPOR	2.14e-276	1	448	1	452	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=cbhA PE=3 SV=1
sp|B0Y793|CBHA_ASPFC	1.66e-270	1	448	1	451	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=cbhA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000307	0.999662	CS pos: 18-19. Pr: 0.9763

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_55993-t33_1-p1.