CAZyme Information: ASPVEDRAFT_55220-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_55220-t33_1-p1
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		39995.45	4.6861

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878132:1698807-1699910(-)

Full Sequence      

MAQYINWSTYKANGVNLGGWLCQESTIDTTWWAANSKGAEDEWGLCANQRNQCGPILERR
YATYITTSDIDKLASAGVNTLRIPTTYAAWVDVPGSQLYSGKQVSFLGNIATYAITKHQM
HIIIDVHSLPGGVNGMPFGEASGHFGWFNNQTAYDYSLQAIDAVIDYVQNQSGNPESYTI
APINEPVDNIASFGFPAALTDNGAAWVLKYILAVNSKVRAVNANIPIMFQGSFRPVSYWS
SKLPSTANIVFDVHNYYFAGRSAAGANITEYICQDAEAAAGDGKFPVFVGEWSIQAELDN
TFAGRQKALNTGLYAFAQYTRGSAYWTAKFSGNATVDGEGTQADYWNYLYFVNNGLIDPS
QGAGVCS

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	61	339	1.7e-140	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.51e-08	1	186	7	191	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	9.14e-06	64	292	24	236	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAG70961.1|GH5_23|3.2.1.149	1.64e-183	4	366	26	389
QMW31304.1|GH5_23	3.43e-174	3	358	29	384
QMW43350.1|GH5_23	3.43e-174	3	358	29	384
BAE61018.1|GH5_23	3.43e-174	3	358	29	384
QRD90261.1|GH5_23	3.43e-174	3	358	29	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	6.04e-176	3	358	10	365	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	3.80e-157	2	358	12	370	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
6ZB9_A	5.82e-12	11	187	2	169	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	1.39e-11	11	187	2	169	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	2.90e-28	5	345	35	353	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q9URU6|EXG1_SCHPO	1.21e-23	5	345	32	390	Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg1 PE=2 SV=1
sp|Q7Z9L3|EXGA_ASPOR	4.13e-23	2	293	21	300	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
sp|B8N151|EXGA_ASPFN	4.13e-23	2	293	21	300	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	8.49e-23	5	293	35	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999935	0.000110

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_55220-t33_1-p1.