CAZyme Information: ASPVEDRAFT_53292-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_53292-t33_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557		59395.03	5.8208

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878129:1617342-1619015(-)

Full Sequence      

MPEHDYIIIGGGLAGSTLAGRLSSSTSARILIIEAGSNVSGHPLTSAPLACFGAHFSPLD
WAYTTVPQAHLGNRECYNSAGKALGGGSAVNYGTWTRGSAADYNEWARIVGDEGWSYEGL
LPHFKRMESYCIRGVGEGVIDTEAHGFDGPIHNVSVSGSSEERVYPLREPLRKAWARLGV
KEIPDANAGSPSGLSELVENWRDGKRQIASEVFGISERPGVTIMTETTVQKVLIEVNERG
KKVARGVQVLGGQTFHAAKEVIISAGAYRTPQVLMLSGIGPQGDLAKHGIDTVLDAPQVG
RNFHDHFAFAQWWKLRRPEKGLSMGTPLWNSPAYGFGIPCDWVATVKAPHDDLIRAFRQD
GETEVEGQHYLTSNACHAETLIAYAPSGALISGVDIPMDGTHIASIVLGMATTSRGCITL
ASASATTPPLIDPNYYATEFDRAVVRAGVRQVATLLLDIPEGQEIVEAEAPRPGFKPLGV
DPTDDEIDARVKAGGNTFYHPAGSAAMGKVVDTELRVKGVDGLRVVDASVLPLPVTAHYQ
ALVYAIADKAADLISAN

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_53292-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	555	4.1e-143	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.46e-99	1	554	3	531	choline dehydrogenase; Validated
225186	BetA	4.00e-88	5	554	9	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.90e-56	5	555	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	8.69e-38	413	550	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.97e-37	72	306	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24407.1|AA3_2	0.0	1	557	1	562
EAA58856.1|AA3_2	6.79e-301	3	554	5	553
BCS16263.1|AA3_2	1.55e-249	3	554	4	551
BCS04695.1|AA3_2	1.55e-249	3	554	4	551
CAK40717.1|AA3_2	8.41e-247	1	554	1	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.43e-64	3	557	6	572	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.00e-64	3	557	6	572	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	2.78e-64	3	557	6	572	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	4.21e-64	3	557	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.62e-63	3	557	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	3.50e-130	5	557	6	521	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|A0A3B1EFP9|STR4_STRTC	5.40e-69	3	554	35	611	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|Q988C9|4PADH_RHILO	2.28e-68	3	557	6	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|B2JS89|BETA_PARP8	3.53e-62	3	554	5	532	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=betA PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	5.28e-62	3	554	4	526	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999889	0.000151

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_53292-t33_1-p1.