CAZyme Information: ASPVEDRAFT_53210-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_53210-t33_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	KV878129|CGC14	40035.83	5.2413

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878129:1339581-1340738(-)

Full Sequence      

MKWIILLSVFLLSYLAAAIPIEAEGTISAPEAVIEVTVDENGRTLSVETIAPTATANNAP
ATLPPILAVPDTEAPHNLEPTLPADANANKKVNDNLPQDKNAEPKGSPRRFGISYSPYNA
DNTCKDQAQVNKDVDRLSHYSFIRIYGIDCDQTRKVIVAARRHQMKVFAGLYDLQKLHSS
LDMIIDAAKPDLSVLHTVSIGNELLNRQQNSADEVINAVADARAYLRGRGYNGPVVTVDT
FSKVFENPELCGVSDYCAANCHAFFDANQTPANAGSYVRDIARRLSAISGGKRTMITESG
WPHAGQNNGKAIPNPDNQRKAIDSLRHSFENEQGDLVLFSAFDDLWKEDNEWTFGAEKFW
GIGNH

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_53210-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.99e-65	112	362	47	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24296.1|GH17	1.70e-239	1	364	1	364
EAA59935.1|GH17	1.44e-166	1	362	1	365
CAK47997.1|GH17	2.89e-124	6	365	7	363
BCS13276.1|GH17	1.25e-120	6	362	7	360
BCS01560.1|GH17	1.25e-120	6	362	7	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	3.31e-12	105	356	32	281	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.98e-11	105	356	32	281	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	1.44e-63	106	362	122	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	6.42e-61	112	362	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	2.99e-57	112	362	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|A1C499|BTGE_ASPCL	2.75e-36	102	361	299	559	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|Q4WC60|BTGE_ASPFU	3.53e-35	110	361	308	559	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000248	0.999704	CS pos: 18-19. Pr: 0.9601

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_53210-t33_1-p1.