CAZyme Information: ASPVEDRAFT_52869-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_52869-t33_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
980		108764.84	4.8465

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878129:223625-227000(-)

Full Sequence      

MKLRHALSAAIASTGFVAHSIAQDWPLHDNGLNKVVQWDHHSIQVNGERLFLWSGELHLW
RIPVPELWRDILQKVKAAGFNGIGLYEHWGWHAPNNETLDFETGAHNFAQAFELAKEIGL
YVVYRPGPYSNAEANGGGFPGWLTTGEYGPLRDDSEEYTRAWTRYAEAVAEYVRPHLITN
GGSIIIWQIENEYGNQWLDRELKTPNETAINYMQLLQDKHREWEIDVPLSHNNPNMWTRS
WSKDYSNAGGEVDMYGLDHYPVSQTQPSFLMEFQGGSFNPWDGPEGGCKENMGPEWVNLF
FRHNLAQKVSAVNIYMLYGGTNWGNIGFPEVGTSYDYSAPIHENRLIGDKYNEGKLFGLF
MRSARDFTKVDRVGNGTGYATDADIFTTELRNPDTGAAYYVTRHDYSPSTDLTRFRLHVT
TQVGNLTIPSKGSITLNGTESKVLVTDFSIGSSGKKITYSTLEVLAVSDLGDRQIVVFWA
PEDEQGEFLLQNATLGKVMRGSGNHNNNNTITRTRNGIVTNVVTGPENTVIDYSNNVQAV
VVDRQSAYKFWAPTLDNDPLAWENSTVLVHGPYLVRTAQITGNTIHVTGDWDEETDIEIW
APKKVTDATFNGANLNVSKSKYGSLIGTLPAAEVTIESLAASLPSLGDWKVADNLPETAA
EYDDSNWTDADHMQTPHFVPPDTYPVLFADEYGYQAGNILWRGHFNASEDELPSGAYLRV
IGGLASGFSVYVNGEFLGSWLGSMANKTGELAVSFQNATLKTNDANVLFVIQDTMGKEQR
EAAPDPRGILNATLYAADGSAASFSSWKVAGNAGGNHLLEPVRGTYNEGGLHAERLGWHL
PGFDDSDWESGVPADGFTGAGARFYRTVVPLDIPRGYDASIAFQLHTDKKAKLRAQLYVN
GYQFAKTLPFISNETTFPVFPGILNYNGYNTIGLSVWNMDEAGVSVGVQWKVMGVHRSAF
DPLFPSEYLRPGWTDRSQYA

Enzyme Prediction     

EC	3.2.1.-:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	45	355	1.3e-78	0.9739413680781759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	1.13e-81	42	353	1	310	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	2.64e-60	368	549	2	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	1.71e-48	366	550	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
166698	PLN03059	1.06e-33	36	343	30	323	beta-galactosidase; Provisional
404274	BetaGal_dom4_5	2.06e-32	832	942	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD93645.1|GH35	0.0	1	980	1	974
QMW34558.1|GH35	0.0	1	980	1	1005
QKD61358.1|GH35	0.0	82	980	502	1444
QMW46613.1|GH35	0.0	142	980	207	1082
UDD63503.1|GH35	0.0	213	980	1	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	7.37e-178	32	946	2	938	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	2.34e-177	6	943	10	971	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	6.51e-177	6	943	10	971	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	2.53e-169	32	947	42	973	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
3OG2_A	1.76e-154	32	946	22	970	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6GW04|BGALB_PENRW	0.0	25	980	29	1013	Probable beta-galactosidase B OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=lacB PE=3 SV=2
sp|B0XNY2|BGALB_ASPFC	0.0	24	975	28	1009	Probable beta-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacB PE=3 SV=1
sp|B2W791|BGALB_PYRTR	0.0	25	980	35	1009	Probable beta-galactosidase B OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) OX=426418 GN=lacB PE=3 SV=1
sp|A1D199|BGALB_NEOFI	0.0	24	975	28	1009	Probable beta-galactosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacB PE=3 SV=1
sp|Q0CMF3|BGALB_ASPTN	0.0	2	980	6	1022	Probable beta-galactosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=lacB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000404	0.999528	CS pos: 22-23. Pr: 0.9698

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_52869-t33_1-p1.