CAZyme Information: ASPVEDRAFT_524633-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_524633-t33_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	KV878127|CGC26	42194.40	3.8485

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878127:552723-554125(-)

Full Sequence      

MGRSLWVIAAFLRGILAADLYVSPDGSDDAAGTIDAPFQSIQLAVDEATNGSTIYLRAGT
YTPTTNIQISKSGTSSAPFVLRAYEREAVIIDGEELPGTPAELDGSLDNEDRGILHIQDA
EYWEFYDLELINGPYGVYARDASNNHYERIVTRDNYETGFQLEGASANNVVLYLDSYGNR
DPRKNGESADGFACKEGSGEGNVLRGARLWNNVDDGLDLWEFKSAVTIEDTISFGNGFNR
WDFSPFEGDGNGFKLGGGDDADIGPANHVITNSIAFGNSHDGFTDNSQPGNFELSRNTAW
NNTAIGFRFGTAVATLSGNIAASNGEKPTSLSEEQVSEGNSWDGDGDWDDGSFVSVDAEL
VQGERNADGTIEGSDFLLPSSGEEIGATTNWSV

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_524633-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL9	17	379	5.1e-152	0.9942363112391931

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271210	PL-6	0.002	42	94	8	59	Polysaccharide Lyase Family 6. Polysaccharide Lyase Family 6 is a family of beta-helical polysaccharide lyases. Members include alginate lyase (EC 4.2.2.3) and chondroitinase B (EC 4.2.2.19). Chondroitinase B is an enzyme that only cleaves the beta-(1,4)-linkage of dermatan sulfate (DS), leading to 4,5-unsaturated dermatan sulfate disaccharides as the product. DS is a highly sulfated, unbranched polysaccharide belonging to a family of glycosaminoglycans (GAGs) composed of alternating hexosamine (gluco- or galactosamine) and uronic acid (D-glucuronic or L-iduronic acid) moieties. DS contains alternating 1,4-beta-D-galactosamine (GalNac) and 1,3-alpha-L-iduronic acid units. The related chondroitin sulfate (CS) contains alternating GalNac and 1,3-beta-D-glucuronic acid units. Alginate lyases (known as either mannuronate (EC 4.2.2.3) or guluronate lyases (EC 4.2.2.11) catalyze the degradation of alginate, a copolymer of alpha-L-guluronate and its C5 epimer beta-D-mannuronate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21969.1|PL9_3	3.88e-282	1	393	1	393
EAA64642.1|PL9_3	3.81e-252	1	393	2	410
QMW39170.1|PL9_3	3.87e-236	17	391	18	392
QMW27106.1|PL9_3	3.87e-236	17	391	18	392
UDD54928.1|PL9_3	3.87e-236	17	391	18	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RU4_A	5.71e-49	21	392	18	383	Chain A, Pectate lyase [Dickeya chrysanthemi]
5OLQ_A	1.99e-23	21	301	6	318	Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLQ_B Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLQ_C Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLR_A Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLR_B Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLR_C Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLS_A Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0C1A6|PLYL_DICCH	5.06e-48	21	392	43	408	Pectate lyase L OS=Dickeya chrysanthemi OX=556 GN=pelL PE=3 SV=1
sp|P0C1A7|PLYL_DICD3	5.06e-48	21	392	43	408	Pectate lyase L OS=Dickeya dadantii (strain 3937) OX=198628 GN=pelL PE=1 SV=1
sp|P22751|PLYX_DICCH	5.65e-29	17	309	388	646	Pectate disaccharide-lyase OS=Dickeya chrysanthemi OX=556 GN=pelX PE=1 SV=1
sp|P94576|YWOF_BACSU	1.90e-11	20	235	36	252	Uncharacterized protein YwoF OS=Bacillus subtilis (strain 168) OX=224308 GN=ywoF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000332	0.999634	CS pos: 17-18. Pr: 0.9701

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_524633-t33_1-p1.