CAZyme Information: ASPVEDRAFT_52409-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_52409-t33_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788		84899.57	6.8393

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878128:1251380-1254394(+)

Full Sequence      

MATQTVLFLTNKELGQATAVLTVAHEFLIRQSYTVHIASFPQLENAVSQLNSQAVALTQS
TSIPAAIFHSLPGRCMVDAATATMPLSDSFAAHQIGFFGALDSYPKLFEFMAPWTGDEYI
AVYQRCVEIIKKVNPSIVVVEPLLAQAIDACRQLGCKYAVLSPNTAKDHVIQPMLGNLWK
YPILSSGYPFPVPWKYILPNALLAINAAIKMARSPAIKAINDRRHAEGIEGPYPIMATSE
GNPVQLLLASHAEIDFPCVVPGHITRCGPILRPHRPLSDENPGLAKWLAQRPTVLVNLGS
NVCFNSEQARNFAHGVRTLLDARPDVQVLWKLKVDRDNDAADWVPMSLKSIFAEVTSGRV
RIEEWLPVEPISILQSGNVCCMVHHGGANSYNEAIRAGVPQIVIPVWYDTYEYAARVEYF
GVGVWGTKQTAPAINGLELGDAFLRILHGEEASTIQEKAKTIASKLGPVEGRMASETVAW
IGLGNIGRGMSRNIALKGPQQSPLILYNRTTSKAEAFAASLTSEKPQSAIAASSLPAAIK
DASITFICVGDDAALDQIISTIISDASLSIKDKIIVDCSTVHPDTSRRTHTTLASHGSTF
IACPVFGAPNAADAGQMVVVPAGSPEAINRIQPFLVGVTSKAVLDLGPESVDDVGRASLM
KVLGNTFILNTVETLAEGMVVAEKSGLGTDAYKQWVSTMFPGPFAKYAERMTSGDYFKRE
EPLFAVDLARKDLRHAANLAGASGMTLPSVKVTDDYLKVVKEESGEKGDIAGVYGAIRKG
AGLRFANQ

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_52409-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	245	464	4.4e-19	0.42670157068062825

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224995	MmsB	2.29e-46	476	778	1	286	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase [Lipid transport and metabolism].
340817	GT1_Gtf-like	4.51e-33	6	468	3	394	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
397486	NAD_binding_2	1.17e-28	477	635	1	148	NAD binding domain of 6-phosphogluconate dehydrogenase. The NAD binding domain of 6-phosphogluconate dehydrogenase adopts a Rossmann fold.
185358	PRK15461	1.72e-16	477	783	3	292	sulfolactaldehyde 3-reductase.
183197	garR	9.36e-13	478	748	5	257	tartronate semialdehyde reductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA57970.1|GT1	0.0	1	788	1	830
BCS26405.1|GT1	2.31e-314	1	475	1	475
BCR88350.1|GT1	2.42e-155	5	475	3	477
QMW30045.1|GT1	1.27e-144	1	473	1	471
UDD61742.1|GT1	1.27e-144	1	473	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1WP4_A	1.03e-12	476	769	2	272	Structure of TT368 protein from Thermus Thermophilus HB8 [Thermus thermophilus HB8],1WP4_B Structure of TT368 protein from Thermus Thermophilus HB8 [Thermus thermophilus HB8],1WP4_C Structure of TT368 protein from Thermus Thermophilus HB8 [Thermus thermophilus HB8],1WP4_D Structure of TT368 protein from Thermus Thermophilus HB8 [Thermus thermophilus HB8]
3DOJ_A	4.21e-12	478	770	24	296	Structure of Glyoxylate reductase 1 from Arabidopsis (AtGLYR1) [Arabidopsis thaliana]
5U5G_A	1.16e-11	475	679	2	195	Psf3 in complex with NADP+ and 2-OPP [Pseudomonas syringae],5U5G_B Psf3 in complex with NADP+ and 2-OPP [Pseudomonas syringae],5U5G_C Psf3 in complex with NADP+ and 2-OPP [Pseudomonas syringae],5U5G_D Psf3 in complex with NADP+ and 2-OPP [Pseudomonas syringae]
2CVZ_A	3.52e-11	476	769	2	272	Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus HB8 [Thermus thermophilus HB8],2CVZ_B Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus HB8 [Thermus thermophilus HB8],2CVZ_C Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus HB8 [Thermus thermophilus HB8],2CVZ_D Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus HB8 [Thermus thermophilus HB8]
3CKY_A	1.76e-09	574	748	93	260	Structural and Kinetic Properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation [Eubacterium barkeri],3CKY_B Structural and Kinetic Properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation [Eubacterium barkeri],3CKY_C Structural and Kinetic Properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation [Eubacterium barkeri],3CKY_D Structural and Kinetic Properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation [Eubacterium barkeri]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	2.63e-91	6	448	8	439	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	6.71e-83	6	469	8	488	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|O34969|YFJR_BACSU	2.24e-15	478	768	3	272	Uncharacterized oxidoreductase YfjR OS=Bacillus subtilis (strain 168) OX=224308 GN=yfjR PE=3 SV=2
sp|M9MH90|EMT1_PSEA3	1.08e-14	315	460	400	540	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	5.19e-13	360	460	442	539	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_52409-t33_1-p1.