CAZyme Information: ASPVEDRAFT_49691-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_49691-t33_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
930		101522.22	6.5423

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878126:107954-111119(-)

Full Sequence      

MAPKEGMLPPGWDDLDRQMGQLFMMGFDGTSVSPEIRSLIENYHLGSILLTAKNLKSAEE
ATRLVMELQMIARDAGHPVPLLIALDQENGGVNSLYDEIYIRQFPSAMGVTATGSKALAH
DVAFATAQELKAVGVNFILGPVLDVLTNVRNQLMGVRTCGDDPQEVSQYGVEFMKGYQKA
GLVTCGKHFPSYGNLEFLGSQTDVPIITETLEQLSLTALVPFRNAIVHGLDAMMVGGVSM
SSAGVNVMHACLSEQVVDDILRKDMKFDGVVVSECLEMEALTHNIGVGGGTVMAKNAGCD
IILLCRSFQVQQEAINGLKLGVENGIIDRIRIEQSLRRVLAMKARCTSWEQALNPGGLPS
LTQMQPSHTSLSTKAYSNSISVVRDKKNLLPLSNILSPSEELLLLTPLVKPLPASAVSRS
VTEQLEMSVDAVAWDRTASVLSGESVFKELGRSLSRHRNGRVLHTSYTSNGVRPIHENLI
DRASAVIIVTADAVRNIYQQGFTKHVSMICRSQFTPSGEPLEKPLVVVGASSPYDFSLDA
SIGTYVCTYDFTDTALEALVKVLYGELAPKGSLPGSFSRSQKLHQARQHWLVENWNEERD
FDALDSLLATAREDTRGQRSELLGVTPNSFLLRRDDIDEAHFVVRNSTTRALYGFCSTYF
FRATGIGVIGSLIVDPSRRKLSIGNSLHNRAIRTLMQRKGLKRFQLGSRLPGIYLGIPAA
NPVERKQLRQWFANLGWNTALSRPVCSVILRSLQTWTPPDGLVCSIQNADVTYDLVHGWD
YADSIIDHVKTNSRQGVIDIYKLALGGAPHCGIIRARRPKDGAILGSVVIYNEQASLAEY
MPGMKATHASTGGISSPVISPSVGEYSTLLQGLVLLGIKQIRRQGAEAVIIDCVDADSNF
DWLTELGFSTLHSFEEVNCDAATWTMVPGS

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_49691-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	303	1.4e-52	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.73e-69	15	393	3	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	6.52e-60	15	340	2	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	2.46e-36	19	353	1	316	beta-hexosaminidase; Provisional
178629	PLN03080	6.50e-08	104	392	114	415	Probable beta-xylosidase; Provisional
185053	PRK15098	1.13e-07	15	343	47	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21378.1|GH3	0.0	1	929	1	966
EAA64546.1|GH3	0.0	1	929	1	922
BCS15461.1|GH3	0.0	1	930	1	931
BAE65506.1|GH3	0.0	1	930	30	961
QMW48185.1|GH3	0.0	1	930	1	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	2.78e-91	13	762	7	702	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	4.43e-67	15	574	13	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.70e-41	15	574	44	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.27e-41	15	574	18	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.26e-41	15	574	48	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	8.74e-41	15	574	44	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	2.08e-32	16	574	29	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	1.22e-30	30	574	49	593	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	4.63e-29	24	323	7	299	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|Q0A911|NAGZ_ALKEH	7.63e-28	24	305	7	283	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_49691-t33_1-p1.