CAZyme Information: ASPVEDRAFT_47420-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_47420-t33_1-p1
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414	KV878139|CGC2	47617.10	7.9256

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878139:323244-324533(+)

Full Sequence      

MFKPRTQKPLLPFTVRRRLSILALVIFLVFLFHSLPSKKDRVVAGKWLPDYDVEDVPRFL
HRSPFRVSPDYDYERRVSEALQKIERDFLENHSGDRSAEERIWQIRLGKSPKEERSADSI
RFSDRNNEWEYTLVADSQADHFLTTVLSSVPDLKKLYDSYPHHVIRSDLLRYLLLWYHGG
YYADTDVYPAKSIKECPSLQPIFADLDSGNGNISLAVGVEIDEPHASPQLMRDWHWIRTY
GLIQYTFYAPQRFSPLLREVIVRVLSHTRQHNQHSFPLIGPRYNEKTILEVTGPGVFTDA
IIDTLSDALPMTHPLISQSVRADEKIGDLVAQPSGELSRRVTWAPFHKISEPVCVDAQEA
AIGKSMGGVCVLPINAWGNGQRHSGAESFRSQHACINHRFGGTWKKDWWHRHIG

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_47420-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	115	196	1.1e-19	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	2.75e-10	126	193	15	83	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	2.24e-08	68	218	50	201	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21634.1|GT32	3.59e-300	1	414	1	414
EAA64318.1|GT32	1.01e-217	6	414	5	417
QMW37982.1|GT32	1.23e-172	49	408	51	407
UCK58385.1|GT32	1.23e-172	49	408	51	407
QMW25899.1|GT32	2.47e-172	49	408	51	407

PDB Hits     

ASPVEDRAFT_47420-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.84e-23	122	407	127	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	6.86e-17	100	407	98	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.80e-15	102	407	146	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999990	0.000041

TMHMM  Annotations     

Start	End
19	36