CAZyme Information: ASPVEDRAFT_470816-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_470816-t33_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486		55406.61	5.9424

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878126:2045833-2047293(+)

Full Sequence      

MSNKFSIRDPSPMNSSRVWKKKFARYFLVACLVGAFFLFGPRFRHEPDIVHIPDDPAKPN
ITLTAHVGCEPDFTVLERLGVTKLSQYLRREVVAIQSPDNLPLTQALDTPLFDQSAKKTS
QTAENALQSDCSIGNQIALRTPRRTRHVDGSHFDFGVATTLERLNESLDAFTHWASRTGV
RIFALIEPDNRVPEVLAKAEALGINLSVTQSNDEYQTRYFSLVSHLAQNLREVTRWSCII
DDDTFFLSMPALIEAFEKYDHTQPTYVGGVSESVPQIGIFGLMGYGGAGVFLSRPLVQRL
SEPEVFEACQQMIHTGDRRISLCVYQHSSAHLTIDHRLRQLDFRGDASGFFEAARQPPLS
VHHWKSWFNTDMAKLSKISEVCGEACLLKKWRFSDGWILTNGFSITKYSREISPDDISME
LTWDGDHDPDRDAFMHELGPLRDRDEGKISYIMADSIMDTDQVRQWYIHRDPEDGDQIME
LVWQRQ

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_470816-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	8.88e-11	235	363	212	341	hypothetical protein; Provisional
367085	Fringe	7.17e-09	235	301	86	160	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	4.16e-06	283	363	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS20602.1|GT31	0.0	1	486	1	486
EAA64847.1|GT31	5.58e-257	1	486	1	503
BCR96997.1|GT31	4.05e-213	10	483	5	476
BCS09474.1|GT31	4.05e-213	10	483	5	476
QMW40633.1|GT31	5.02e-213	10	486	9	485

PDB Hits     

ASPVEDRAFT_470816-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPVEDRAFT_470816-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999963	0.000060

TMHMM  Annotations     

Start	End
23	40