CAZyme Information: ASPVEDRAFT_46397-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_46397-t33_1-p1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721	KV878136|CGC3	78912.57	4.9465

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878136:348220-350385(-)

Full Sequence      

MSAEYTFTDALAALNSGKSLPETTTTLLSQLTKAERLSLLDGDTPFWAGQRSILLNRYNP
VPYTHGSIPRLSIPGIKFTDGPRGIVMGHSTAFPVSMARGATFDISLEHRVGHAIGLEAK
AQGANFYAGVCINLPRHPAWGRIQETYGEDPVLLGEFGVALTTGVQGHVMACVKHFALNS
MENARFRVDVRVAEDVLREVYLGHFRRVVQEGGAAGVMSAYNSVNGEWAGQNRDLLIEIL
REEWGFDGLVMSDFVFGLRDAALSVRNGLDIEAPFIQQRSMHLESALESGRLSLEDIDRA
CERILRKQLEFAVRTQDSQPGLDVVFCDEHRALAREVAARSMVLLKNGPVNGQPILPLQT
DNLKRVAVVGRLANIANTGDKGSSQVYPPSVVTPFEGIREALPDVEVLFADTKDEAEKLA
SQVDTVICVVGYTYEDEGEYITPPLEDNPALRACLPPTKTDEERETLAMFEGKIDSGGDM
KPGIGGDRTSLRLREEDEKLIAAVAAQNSNTVVSMVAAGAVIMENWKDKVPAILMSWYSG
SEGGHGLADVLLGRVDASGRLPFSIPTDEAHLPFFDRDATEIEYTRWFGQHLLDKLGVEA
AFPFGFGLSYTTWEVEGATAVKLDDDNIQVNFTVRNTGKREGRFIAQVYGLPGVKDFPRR
VLLGFIPVDIEAGKAKKVQVSASLRPVQKWDNGFSLRTKQLKIEVAGFAGDKQCAETEIS
L

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_46397-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	67	272	4.8e-57	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	9.77e-71	70	679	101	722	beta-glucosidase BglX.
224389	BglX	2.71e-58	68	401	55	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.47e-57	64	681	72	741	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	6.90e-51	342	610	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	9.06e-37	70	306	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28742.1|GH3	0.0	4	721	5	723
AGC95327.1|GH3	0.0	2	721	4	725
UCK59088.1|GH3	0.0	4	720	6	724
BAE55411.1|GH3	0.0	4	720	6	724
QRD87369.1|GH3	0.0	4	720	6	724

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.39e-79	68	685	32	630	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	6.34e-78	27	649	7	638	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	8.73e-77	27	649	7	638	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	9.74e-72	73	695	37	635	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	3.81e-68	27	691	57	796	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14002|BGLB_ACET2	1.23e-78	68	685	32	630	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
sp|A7LXS8|BGH3A_BACO1	2.52e-72	69	649	74	669	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
sp|F6C6C1|APY_BIFBA	4.16e-72	73	717	37	667	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
sp|P27034|BGLS_RHIRD	2.14e-71	27	649	5	734	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|E7CY69|APY_BIFLN	3.86e-70	73	705	37	657	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_46397-t33_1-p1.