CAZyme Information: ASPVEDRAFT_46087-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_46087-t33_1-p1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
270	KV878135|CGC13	28519.13	3.7471

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878135:663108-663920(+)

Full Sequence      

MYRLNILILTVQCALAAASSSGCGTSPSIDSGVNQADVNGQQREYIIQLPDNYDSNNPYK
LVIGYHWLDGSMDTVVDGSFYGLAPLAADSTIFVAPQGLNAGWANTNGDDLTFTDQILDA
VQSNFCIDQDRIFAAGWSYGGSMSYSVACSRADVFRAVAVLSGGELSGCDGGNDPVAYFG
QHGISDDVLPIDSGRQLRDHFVQVNGCDSADPEEPAAGSGTHTATDYTGCSEGYPVEWVA
FDGGHVPTPSDAGAADSFTPGLIWDFFSQF

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_46087-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	39	165	4.7e-24	0.5903083700440529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	1.50e-19	7	269	11	306	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	4.23e-10	39	164	374	506	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
226584	COG4099	3.29e-07	40	195	171	335	Predicted peptidase [General function prediction only].
395257	Peptidase_S9	4.29e-07	100	159	34	93	Prolyl oligopeptidase family.
223477	YpfH	6.91e-06	115	263	84	206	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD56959.1|CE0	6.57e-147	16	270	20	275
AXF48684.1|CBM1|CE0	4.14e-111	20	270	90	340
CAC85738.1|CBM1|CE0	5.10e-108	22	270	96	344
AVT34021.1|CBM2|CE0	3.32e-106	18	270	24	276
AVT41696.1|CBM2|CE0	4.71e-106	18	270	24	276

PDB Hits     

ASPVEDRAFT_46087-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QYU7|FAEC_ASPNC	9.02e-94	5	267	9	267	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
sp|Q0CDX2|FAEC_ASPTN	8.44e-92	16	268	20	268	Probable feruloyl esterase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=faeC PE=3 SV=1
sp|Q7RWX8|FAED_NEUCR	7.54e-90	3	270	7	289	Feruloyl esterase D OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=faeD-3.544 PE=1 SV=1
sp|Q5B2G3|FAEC_EMENI	7.89e-90	18	267	22	267	Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=faeC PE=1 SV=1
sp|A1C9D4|FAEC1_ASPCL	4.19e-85	14	267	20	269	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000546	0.999467	CS pos: 22-23. Pr: 0.6588

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_46087-t33_1-p1.