CAZyme Information: ASPVEDRAFT_44751-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_44751-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407	KV878132|CGC12	45218.53	4.7208

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878132:1572421-1574115(-)

Full Sequence      

MRLLLALLAAVSIVAATILENGQPRLEPYPGHAQLLGSEVGEGWKTYGADADEISYKGRW
DKDHVSWWSAAGIKFAFTGKKLALSFGNHTSDGVLVAYRIGGQDWEFANVTANNSYQFVG
PWTTGVNLTEAAGHKTFELRVTNWAYGVQLAGVAVDRGAALYNIQPFPKMVEVIGDSLSS
GDFATYEGLSSWAYLFAAGLGNVEYHLTAYPGICLVDQNCWGNPRGQIHQWYRVSDTSPR
AAEIHGEDPPEWDFKAQQPADLVVINIGTNDNNEANNVSSIDYYNDYVKLVGDVHRIWPD
AQIVLMSLWGGFGASGDTYVQGPLFVKEIRNVYESFQDNGTFVHYFDTTGILQQNDIGPM
WHPTDVGHIKIAAHFMQWVKIKFGWEMEATGPMVHSGTLYWNDQENY

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_44751-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	171	377	3.4e-26	0.9808612440191388

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	1.31e-52	170	380	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	1.14e-13	171	377	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	3.36e-13	173	368	1	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238881	SGNH_hydrolase_like_6	1.26e-05	248	375	46	173	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238871	XynB_like	4.06e-05	256	375	37	153	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17295.1|CE0	1.63e-293	1	407	1	400
EAA62480.1|CE0	1.29e-175	1	407	2	307
CBF82105.1|CE0	1.29e-175	1	407	2	307
QMW34907.1|CE0	2.26e-172	1	407	1	398
QMW46983.1|CE0	2.26e-172	1	407	1	398

PDB Hits     

ASPVEDRAFT_44751-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPVEDRAFT_44751-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000195	0.999784	CS pos: 16-17. Pr: 0.9537

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_44751-t33_1-p1.