CAZyme Information: ASPVEDRAFT_43928-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_43928-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
619	KV878131|CGC2	67400.15	6.1618

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878131:1467130-1469194(-)

Full Sequence      

MKSLFPSLLFPLAFARQFSPAAQTVTQHDADLLPEYDYVVVGGGVSGLTVANRLTEDSNT
TVLVIEAGKIDDYSKGIQYPRFARSVSANYSWPITSLPIDGLNNRTAPVVVAQILGGGSA
INGMAFMRGSPGDYDLWAELIGDRSWGWDGLLPYFKKSETFTPPTDAQQSEHGISFDMDA
RGTNGPIQSSFPPYITSTGRVFLAALRQLGIPTQIDGSANALGGYWSPNNLDPVTRERSY
ARTGYHDSANTRSNYHVLPETLVTRLTPDLMGVEYIPEYNTALNSTPPDIKIKTVRARKE
IIMAAGAIHTPKILHLSGIGSSAVLRDLGVNQILDVPGVGENLQDHPTIYGSVALTNLSD
PTQDPLYIWNNATYDAEMGLLYEANRTGPWTVGTENTFSFLTAKHLNFSVSHFEHAAGQP
ARYLRSGLDPSIIRGYEKAQNLLLKHMTDNKVALSENLLISIISLQKPLSRGSVHAGSTD
PYAMPHVSYRTFSNPLDLEMLAQAVRLQTDILPQTPALQSIGAVLEFPKPGLTNTELKDT
IKESADPNFYHPVGTCAMLEFTDGGCVDSQLRLYGSRGRVRVVDASIFPIIPSAHTQSTV
YAVAEKAADLIRGVHTVPH

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_43928-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	35	612	3.2e-160	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.84e-84	51	613	21	533	choline dehydrogenase; Validated
225186	BetA	1.58e-80	49	615	21	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.07e-32	468	607	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.29e-29	103	348	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.00e-12	296	600	277	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29283.1|AA3_2	0.0	1	619	1	620
CCA74023.1|AA3_2	5.05e-136	20	606	25	605
BCS29521.1|AA3_2	1.06e-133	23	612	31	618
QGJ00970.1|AA3_2	2.61e-128	22	612	20	607
CCT74664.1|AA3_2	2.61e-128	22	612	20	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.44e-117	36	615	6	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	1.19e-95	30	611	30	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4H7U_A	3.42e-67	21	611	23	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
4YNT_A	1.31e-63	36	612	6	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	6.00e-63	35	612	1	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	2.32e-104	4	615	9	617	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	3.37e-93	12	613	22	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	3.37e-93	12	613	22	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	1.13e-76	37	612	41	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|P0DO29|ERIK_HERER	1.13e-70	12	615	8	599	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.840580	0.159447

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_43928-t33_1-p1.