CAZyme Information: ASPVEDRAFT_42281-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_42281-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	KV878129|CGC18	52361.04	8.9025

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878129:1924203-1925736(-)

Full Sequence      

MTTAFSPKLTASRSPCLLDPNQPVKSLSIAFWLWKTLLFVVIISCPGLGYDTSSSLLPYQ
NNHSVVDVISSVQSKQEYISIPLKFLRWDSIYFVHIGRIGYVFEQEWAFSYTYSNLVNYL
SSFLFPSDDSNGVAGFAVTGVIVSHVAHYLSVLALYRLSINVFGHDSQRKRLVCFLAAAL
HIISPAGAFLTAPYMEAPFSFLNITGLYIYSSSHIDLDSGKRSLSHMKLLLSGCFFAVAT
TVRSNGILSGIPLVFDALIHSYDIVSRRSFWAAGIRLCFVILSGCIVALGFAVPQYFAYT
KFCMDDSISRPWCQSLVPSIYGWVQAHYWGVGFLRYWTVSNIPLFLLAAPMLLILFLSSF
WAMGAGTPAPAFNVSLKSVSAPSSSPASMLLTRLAVAQFILTAMALTSYHVQIVNRISSG
YPLWYWYLACQALGTSERTLPAAKNNNYFPALVQVMAIYALVQGVLFGSFLPPA

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_42281-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	31	474	1.3e-111	0.9877149877149877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	5.47e-38	86	474	58	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	4.83e-18	87	474	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24525.1|GT76	0.0	1	474	1	473
QMW40534.1|GT76	2.71e-172	15	474	10	452
QRD82967.1|GT76	1.09e-171	15	474	10	452
QMW28463.1|GT76	1.09e-171	15	474	10	452
BCS01167.1|GT76	2.79e-171	11	474	9	469

PDB Hits     

ASPVEDRAFT_42281-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	2.42e-166	15	474	10	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	5.84e-141	3	474	5	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.26e-79	17	474	3	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	6.64e-79	21	474	16	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	5.17e-47	26	474	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.841526	0.158473

TMHMM  Annotations     

Start	End
342	364
389	411
448	470
28	50
133	155
172	194
272	294