CAZyme Information: ASPVEDRAFT_41649-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_41649-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641		71571.24	4.3151

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878129:362013-363938(+)

Full Sequence      

MFYPYYWTYLWAALVNGIDTRDQGQLPAVWPPPQEISSSGADISLNDNVTIVTGNFTDSA
TIDAVKAIVDSAGGNAVLSSEPTDSGTQIVVGTDKVASDVAEALTGKSAEGLAAEGYVLA
SGSYKDQPSIVLNGMDTRGTFYASQTLRQLVSDDNVPGVKVRDWPLMEIRGSIEGFYGVP
WSHQARLDQLAFYGKHKMNTYIYTPKDDVLLRNEWRTLYGDDEVSQLKELVDGANEHHVD
FTYALSPGLDLCYSSDDDFNATATKFNQIRDLGVHSFYIALDDIPLEFHCDSDSEKWEET
DDYRWIADAQAYYLNRVQKEYIEPNNLKDLQTVPTNYAGSAPDPYKEEFGTKLNKKIRVQ
WTGEGVFSPNVTVESVSRAASTYVTDNLYIWDNFPVNDGDRNRLFLNPLTDRDSDLYEHL
IGFTSNPMSQAYASMLSLANYADYTWNGPAYNANKSMDAVLLELTGTDRSVHEAVLAFTD
LNQYWPYREPAVHSPQLNKDIEAFWAARNASTKAHYKYRKNDGTEALRSRLELLTTLPDV
LPRMAMKEFAEDVAPWSILAMQWATACQHLIAMLDALDAGDKSTADSEFKTAQTWIEKTK
AKTVDDRNSDGEDLPNSITPVTGEEAFGGFANRTIAIHNDQ

Enzyme Prediction     

EC	3.2.1.52:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	170	479	3.4e-98	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400097	NAGidase	2.55e-142	170	478	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
397121	Glyco_hydro_20b	9.02e-19	27	163	2	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29831.1|GH84	0.0	1	641	1	644
UNI17085.1|GH84	8.78e-318	16	634	20	646
CAP80500.1|GH84|3.2.1.52	3.63e-315	16	639	30	647
QLI71395.1|GH84	4.01e-305	16	636	41	665
QSS72306.1|GH84	1.79e-302	25	641	37	654

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CBI_A	4.69e-81	17	575	2	547	Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase [Clostridium perfringens],2CBI_B Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase [Clostridium perfringens],2CBJ_A Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase in complex with PUGNAc [Clostridium perfringens],2CBJ_B Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase in complex with PUGNAc [Clostridium perfringens],2V5C_A Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure [Clostridium perfringens],2V5C_B Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure [Clostridium perfringens],2VUR_A Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death [Clostridium perfringens],2VUR_B Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death [Clostridium perfringens],2X0Y_A Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds [Clostridium perfringens],2X0Y_B Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds [Clostridium perfringens]
5OXD_A	5.96e-81	17	575	4	549	Complex of a C. perfringens O-GlcNAcase with a fragment hit [Clostridium perfringens]
2J62_A	6.56e-81	17	575	2	547	Structure of a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2J62_B Structure of a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2WB5_A GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens],2WB5_B GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens]
2YDQ_A	3.18e-80	17	575	4	549	CpOGA D298N in complex with hOGA-derived O-GlcNAc peptide [Clostridium perfringens],2YDR_A CpOGA D298N in complex with p53-derived O-GlcNAc peptide [Clostridium perfringens],2YDS_A CpOGA D298N in complex with TAB1-derived O-GlcNAc peptide [Clostridium perfringens]
6RHE_A	3.34e-80	17	575	4	549	CpOGA D298N in complex with hOGA-derived S-GlcNAc peptide [Clostridium perfringens ATCC 13124]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0TR53|OGA_CLOP1	1.16e-77	17	632	32	649	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
sp|Q8XL08|OGA_CLOPE	7.97e-77	17	632	32	649	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
sp|Q89ZI2|OGA_BACTN	1.75e-66	10	556	9	519	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
sp|O60502|OGA_HUMAN	6.22e-39	171	468	63	347	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2
sp|Q8VIJ5|OGA_RAT	6.22e-39	171	468	63	347	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.753122	0.246876

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_41649-t33_1-p1.