CAZyme Information: ASPVEDRAFT_40415-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_40415-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	KV878127|CGC9	50323.66	9.5484

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878127:3444672-3446341(-)

Full Sequence      

MASVFRNPAAIYGAAIGLRVALLFYGAWQDAHSAVKYTDIDYMVFTDASRYVSQGESPYS
RDTYRYTPLLAWMLLPTTWAIPGFFSFGKALFALSDVVAGWLVAKSLVLTHGMTTGCALK
YASFWLLNPMVANISTRGSSEGLLGVLVIALLWAVLNRRIYLAGILLGLGVHFKIYPFIY
GVSTLWWLDDDRLTTAATPATPRVSESRETEPKSNNATTKPPGERTKLEPTTTPVSIASQ
IINFITPCRIRLTLTSLLTFAALNATMYLRYGTPFLQHTYFHHLTRIDHRHNFSPYSTLL
YLTAAADPTSGHGSPTGSFESLAFIPQLLLAVVLIPLVLGKKDLPGTMLAQTFAFVTFNK
VCTSQYFLWYLIFLPFYLPTSSLLQNPRLGAFVAALWVVGQALWLQQGYLLEFLGMSSFV
PGLFLASLGFFAVNAWILGVIVEDIGRGTRVVKSQ

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	134	442	3.9e-96	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	6.77e-90	14	442	14	415	GPI mannosyltransferase
252941	Mannosyl_trans	4.01e-72	134	442	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	7.77e-04	55	179	47	181	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23199.1|GT50	1.36e-302	1	455	1	455
EAA63338.1|GT50	1.74e-249	1	446	1	429
BCS05340.1|GT50	3.66e-211	3	449	10	423
BCS16894.1|GT50	3.66e-211	3	449	10	423
UDD65877.1|GT50	1.05e-208	1	445	1	410

PDB Hits     

ASPVEDRAFT_40415-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B7W0|GPI14_EMENI	3.09e-250	1	446	1	429	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	1.87e-209	1	445	1	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4WAH2|GPI14_ASPFU	1.09e-208	1	446	1	422	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	1.85e-165	5	447	7	410	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	1.98e-163	1	447	19	487	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000002

TMHMM  Annotations     

Start	End
10	28
69	88
108	127
134	156
160	182
250	272
323	340
352	374
389	411
418	440