CAZyme Information: ASPVEDRAFT_40356-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_40356-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409		46258.63	4.7307

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878127:3274224-3275912(-)

Full Sequence      

MWFARLLLSTLLAWSLSVSATILENGQPRADPYPGQVNAISLDSSWRTYDADAPEIAYKG
RWDSKHISLWLAPGIKLRFSGPKLAISFGENTNEGTMIAYRIGTLDWLFSNVTADSTYQF
VGEGTQYEELPGDGEHIFEMRVTNWGIGVQMAGASVDVDHYLSKPPTFKRKVEIIGGSLT
GGQYATYETLSSWAFLYAQGLGNVEFGITAYPGACLADLQCYGGGTHGTIWYWHKASDPG
SRAAGMYGHEPEEWDVTAEQPADLVIIQMGGNDHRHPNEIPGENFYDGYIEVIEDVHKHW
PDASIVIMTQWGIWEQEGAEYTQTTVYEEEITRVYEHFKDRRWNFVYLFHANGILSHNDI
NPKNHPTDVGHIKIASHLLQWTNLMLGWELNPRGQMTSQTLYWNNMENY

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_40356-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	183	380	4.7e-17	0.9282296650717703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	2.45e-49	171	382	1	168	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	5.23e-14	172	380	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	9.12e-09	239	371	42	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238872	SGNH_hydrolase_like_2	4.73e-04	171	380	3	190	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	0.001	261	378	78	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23119.1|CE0	3.49e-309	1	409	1	409
ABF50860.1|CE0|3.1.1.-	8.16e-263	1	409	2	402
EAA63262.1|CE0	2.59e-252	1	409	2	392
QQK40140.1|CE0	1.55e-201	8	409	7	407
CAP91491.1|CE0	1.43e-159	9	409	8	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XVH_A	2.49e-06	56	388	2	329	Crystal structure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]

Swiss-Prot Hits     

ASPVEDRAFT_40356-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000550	0.999424	CS pos: 20-21. Pr: 0.9737

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_40356-t33_1-p1.