CAZyme Information: ASPVEDRAFT_393860-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_393860-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813	KV878139|CGC4	88830.59	8.6640

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878139:551484-554179(-)

Full Sequence      

MEADQLPKYSMLEPSMENPTLLDGPQVQDDGRINIDLDSKLCRTLSKLIPIQHQEPPSSP
PPPYSLENTSCKLQLNIVIQVVGSRGDVQPFIALGNELQLHGHRVRLATHGVFESFVRDS
GLEFYPIGGDPSELMAYMVKNPGLIPQMQSLQGGDIQRKRAMVAEMLQGCWNSCISDDPV
TRTPFVADAIIANPPSFAHVHCAQALSIPLHLMFTMPWTSTRAFPHPLANLKYSTTEPKM
ANHLSYGIVEWMTWQGLGDIINRWRDSLDLEPIPTTEGPGLTETLKVPFTYCWSPSLAPK
PSDWKSNIDVCGFFFRSPPSYTPPAELDSFLRNGSTPVYIGFGSIVIDDPAAMTTIIVNA
VKSLGIRAIVSRGWSNLGEPSSNDQIFYLGDCPHEWLFQHVAAVVHHGGAGTTACGLRFG
KSTTIIPFFGDQLFWGEMVASRGLGPKPIPYKSLTTHKLADAIRFCLQPTAQSAARDVAK
RMSHENGVSAAVASFHRNLPVNTMACDVLDSEAAVWQWGKGTKRPIYLSKVAAAILLDHH
RLKLSDLQPYQTHPVLIQNRRWDPATATAASLLGTSRNILKATGDIAYRPYKEFRRSPQS
HPDLLSDISSPRSLSVASETDADATSSPAGYKQSMLKTTGTAMGSSAKSLGKVFGYWSKG
MLVDIPLAASEGLRAVPRLYGDEVKEHGNVQDWKSGATVGGKNFVHGMADGFSDLVMQPY
QGGQLEGARGVVKGFAKGTLGMTTKVSSAALGLVAYPAQGAMKSLYTATHSKTRKRILQA
RILEGKYLAENSPMGQKNRRAVIQRFEAACRNY

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	100	496	4.7e-54	0.9659685863874345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	9.26e-81	75	497	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.01e-43	77	493	4	389	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	7.62e-26	77	225	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
227376	MRS6	1.07e-06	585	761	2264	2409	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP86726.1|GT1	0.0	28	808	25	804
QMW26390.1|GT1	0.0	24	808	31	805
QMW38469.1|GT1	0.0	24	808	31	805
CAK48301.1|GT1	0.0	7	808	22	839
UCK58945.1|GT1	0.0	27	808	35	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.63e-73	82	499	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	4.41e-73	82	499	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	7.74e-30	75	491	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	1.18e-29	75	479	1	362	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.31e-26	75	491	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	4.12e-130	74	500	155	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	1.02e-126	75	500	193	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|P0CN91|ATG26_CRYNB	5.63e-79	10	499	967	1463	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1
sp|P0CN90|ATG26_CRYNJ	5.63e-79	10	499	967	1463	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1
sp|Q4WID6|ATG26_ASPFU	1.65e-76	62	499	889	1319	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_393860-t33_1-p1.