CAZyme Information: ASPVEDRAFT_38965-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_38965-t33_1-p1
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763	KV878126|CGC4	82639.06	5.0557

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878126:4476408-4478846(+)

Full Sequence      

MKVLSALAQAALVHGTVCLAGYTNESEVPYYGRSPAVYPSPVGNRSTSTAWEDAYRQARS
IVSQLTVEEKVNLTRGHDGQCVGNSGAIPRLSIPSLCFSDAPDGLRGQEFVSAFPAGIHV
AATWDRSLMHQYGNAIGEEYHDKGVHVALGPVAGPLGRIARGGRNFEGLSADPYLAGAGM
GEITKGIQEAGVIATAKHWLLNEEEWRRNPGDMGEALSSNVDDRTLHELYAFPFMDSMRE
GVGSVMCSYQRANHSYGCQNSKLLNGVLKTELGFEGFVVSDWEAQHAGVASANAGLDIVM
PDGGFWGNNLTRAVKNGSVSSDRLDDMVTRILAAWYLTGQDEGFPSPGIYSEADKHDPIN
VQRDHADLIQEIGSAGTVLVKNVNNTLPFTKSTKFLSVYGYDATVSASPWSNPSRYGGGY
EVNFGWTTFNGTLVTGGGSGGSTPPYVVSPFQALQERTAKNRGTLRWDFYSQNPSPAYVN
SDACLVFINAYASEAFDRTTLADDFSDSLVKNVATNCTNTIVVVHSAGIRTVDAWIDHPN
VTAVLFAGVPGQESGHSLADILYGDINPSGRLPYTVAKSESDYGSLLNSTVSFDAFPEVN
FTEGLYIDYRAFDRKEITPRFEFGFGLSYTTFTYSDLRVKSAGNSTSALVNPSITIVQGG
HPELWDTLFEVTTSITNTGDVAGSDVPQLYVSIPNAPVRQLRGFERVQLKPKETKTVTFP
LTRRDLSIWDVVAQQWRLQAADYNVFVGASSRILHLNGSLTVE

Enzyme Prediction     

EC	3.2.1.21:10	3.2.1.37:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	87	301	2.4e-57	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.79e-53	90	752	101	755	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	9.79e-53	377	609	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	1.82e-52	87	411	54	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	5.55e-41	17	719	16	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	4.61e-37	90	332	63	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD57003.1|GH3	0.0	1	763	1	764
QRD83483.1|GH3	0.0	1	763	1	764
QMW32072.1|GH3	0.0	1	763	1	764
QMW44102.1|GH3	0.0	1	763	1	764
BAE62494.1|GH3	0.0	1	763	1	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IIB_A	3.23e-206	34	760	6	837	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5FJJ_A	7.51e-205	34	760	7	838	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5JU6_A	6.06e-199	34	760	25	851	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5FJI_A	1.62e-198	34	760	6	840	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5NBS_A	3.41e-198	38	756	24	852	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UDK7|BGLM_ASPOR	5.55e-276	26	762	28	768	Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglM PE=3 SV=1
sp|B8N5S6|BGLM_ASPFN	1.11e-275	26	762	28	768	Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglM PE=3 SV=1
sp|A5ABF5|BGLM_ASPNC	1.60e-264	26	762	27	765	Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglM PE=3 SV=1
sp|Q4WR62|BGLM_ASPFU	5.21e-264	12	762	14	769	Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglM PE=3 SV=1
sp|B0XPB8|BGLM_ASPFC	1.48e-263	12	762	14	769	Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.496682	0.503313	CS pos: 20-21. Pr: 0.4460

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_38965-t33_1-p1.