CAZyme Information: ASPVEDRAFT_38558-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_38558-t33_1-p1
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783		86847.58	4.6433

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878126:3395660-3398011(+)

Full Sequence      

MWLIKILTTLLLQSILATSLPNSSNITSADPGPGGNSPIRPFRLDQVRLGSGLLQEKRDR
ITAFLHDYDERRFLILFNNQAGRSNPDGISVPGGWEDGGLLSGHWTGHFMTALSQAYAEQ
GDDADLYKNKLDWMVAELAACQKAITARMDGTAPGKAGNASWIPTHPGYLGALPEDTVLR
LGPPRWAIYGADAEKDTWAPWYTQHKIMRGLLDAYYHTNNTQALDVVVEMAKWAHLALTI
GDKNHPDYPGNITRDDLNYMWDLHIAGEYGGANEVFSEIYQITGDARHLDTAKTFDNRES
LFGAAVEDEDILVVSPDAIPGRRRAAQLHANTHVPQFVGYMRIYEHSGEEAYHSAAKNFY
AWVAGHRTFAHGGTGGKFPNSTDNPELFQNRDNVANAIEFEGAETCTTYNMLKLARDLFL
HARTDDDDDDAAAYMDNYERGLFNMIAGSRADRDSLDEPLVTYFQPLTPGAVREYGNTGT
CCGGTGMESHTKYQETVYLRSADGSALWVNLYVPSSLDWEERGFKVTQETAFPRGDTVKL
TITGDGKLDIKLRVPGWVHKGFHVTFNGEQYESDAVPGTYLTLSRIWKTGDQIEIRMPFT
IRVERALDRPDTQSLMWGPILLQILGSPSNSFQELTLYKNLKLDGDYSAAIKQTGTTARG
DPLFSSGNFTVRPYYISDDKSASSYFRRTEPVVVFGSIDTDVPNRKRDDGLPDYDVPVGG
IESPGDDGPTFLDLVWDRAPFDNHEDFVEAVTDVADAFVDAGVYTEKERDSIIAGAEEAK
GSL

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_38558-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	46	622	4e-168	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400342	Glyco_hydro_127	7.19e-107	46	622	1	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
226063	COG3533	1.89e-62	40	643	10	521	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI22497.1|GH146	0.0	22	783	31	787
BCB86917.1|GH146	0.0	14	783	29	1020
SBT46463.1|GH146	0.0	26	783	51	1030
QOC92017.1|GH146	0.0	21	783	47	1029
QBZ61184.1|GH146	0.0	30	783	59	1053

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.65e-75	36	622	22	559	Chain AAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.96e-71	36	622	22	559	Beta-L-arabinofuranosidase [Bacteroides thetaiotaomicron]
6EX6_A	2.00e-14	202	606	143	524	The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	7.97e-14	403	621	332	558	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.41e-13	434	621	356	558	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

ASPVEDRAFT_38558-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000314	0.999630	CS pos: 17-18. Pr: 0.9689

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_38558-t33_1-p1.