CAZyme Information: ASPVEDRAFT_38312-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_38312-t33_1-p1
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612		68239.04	4.3976

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878126:2708328-2710562(-)

Full Sequence      

MPPLARAVFLSLAVAGLAAAATPYALQTPPLTTDWTEEVGTNPWPEYPRPQMQRSLWKNL
NGVWEYRNAGGPGAVDTPPFGQSLDTEVLVPSCLESGLSGLQGNANSTVYSWLSTNFTVP
KDWDGDSVLLNFGAVDNEATVFVNGQEAAFHRGGYFEFTVDVTKYINFDAANELLVFVYD
PTDAQGTMVPVGKQTLNPSHIFYTPCSGIWQSVWLESAPAERISRLDVAADMDGEVTVTV
HSETGKDASVDIKVLNGDEEIASHTGTANQQFTFTVDDVKVWSPDTPNLYNLTVTLGKDT
VSSYTGFRTVSRGNVNGVERPLLNGEFTFVFGTLDQGYWPDGLHMPPTREAMVYDLKVLK
DLGFNMVRKHIKIEPGLFYRAADELGLLVIQDMPSMPQRQPDAAQQAEFGRQLELMINQL
KSHPSIFSWVIYNEGWGQLDNGEPEYGLTERVRNLDPTRLINAVTGWYDHGAGDFSDNHH
YANAQCGTPYWSSLSSPYDPKRIALQGEFGGIGHNVSIEHLWNVQQAIDSIPETYEIDET
LEVWNYRSRFLLSELREQIQRFACSGAVWTQTTDVEGEVNGLITYDRRVKRVDEKQWRDD
IESLYSAARGRA

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	50	485	1.2e-102	0.5093085106382979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	2.53e-36	47	465	3	449	beta-D-glucuronidase; Provisional
225789	LacZ	6.36e-35	43	468	1	455	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236673	ebgA	1.95e-21	117	475	117	478	cryptic beta-D-galactosidase subunit alpha; Reviewed
395572	Glyco_hydro_2	7.57e-14	227	308	11	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236548	lacZ	6.67e-13	207	459	207	483	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS20338.1|GH2	0.0	1	611	1	613
EAA64506.1|GH2	0.0	10	612	14	613
UDD59220.1|GH2	6.74e-315	21	608	32	628
QMW41001.1|GH2	9.56e-315	21	608	32	628
QMW28926.1|GH2	9.56e-315	21	608	32	628

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.48e-116	31	596	12	574	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6ED2_A	1.15e-29	47	465	30	473	Chain A, Glycosyl hydrolase family 2, TIM barrel domain protein [Faecalibacterium duncaniae]
6ECA_A	6.55e-28	47	477	31	508	Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus],6ECA_B Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus]
7KGY_A	3.34e-24	112	459	72	445	Chain A, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_B Chain B, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_C Chain C, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_D Chain D, Beta-glucuronidase [Faecalibacterium prausnitzii]
5C70_A	4.51e-24	59	590	22	587	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPJ7|PLH8_FORAG	3.76e-24	44	469	40	473	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|T2KM09|PLH16_FORAG	9.48e-22	95	466	92	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|P77989|BGAL_THEP3	2.60e-19	111	464	58	415	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|Q56307|BGAL_THEMA	9.68e-18	23	462	2	465	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
sp|P05804|BGLR_ECOLI	4.19e-17	58	464	13	444	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999711	CS pos: 20-21. Pr: 0.9719

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_38312-t33_1-p1.