CAZyme Information: ASPVEDRAFT_376256-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_376256-t33_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
567	KV878138|CGC4	61576.39	5.2960

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878138:328169-329966(+)

Full Sequence      

MFSVSNQNSFNAHCCSDNYSKDIQYPRFAQTVSENYSWPITSLPTAGLNNRTTSVVAARI
LGGGSAINGMAFTRGSPGDYDLWAELVGDDAWGWDGLLPYFKKCETFTPPTEAQQIEHGI
SFDLDVHGTNGPIQSSFPPFITTTGKVFLTALRQLGIPTQLDGSANALGGYWSPNNLDPA
TRERSYARTGYYDSADARPNYHILPEALVAKLTPNLTGVEYIALYNPALNSTTDTKTIIE
TVRARKEIIMAAGAIHTPKILHLSGIGSSAILYSLGINQILDIPGVGENLQDHATLYGSL
ELTNLDDPTQDPNYLKENATYDAEMGMLYEANRTGPWTVGTENTLSFLTAKHLNFSTSNF
VHAADQSPEQYLRPGIDRSVARGYEKAHDLLLKYMVKDKVALTENLLVTIISLQKPLSRG
SVHAASADPYKMPEVSYRTFSNPLDLQMLAQAVHFNTDLLPQTPALKSIGAVVTSPEPGL
ATPELMNTIRESAVPSFFHPGGTCAMLKFEDGGCVDNELRLYGSRGRVRVVDASIFPVIP
SAHTQSTVYAVAEKAADLIKGVGVEGV

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_376256-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	21	560	3.4e-140	0.9225352112676056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.55e-72	36	561	62	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.01e-69	33	561	60	533	choline dehydrogenase; Validated
274888	Rv0697	4.26e-41	29	559	57	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	2.81e-33	416	555	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.62e-29	49	293	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29283.1|AA3_2	0.0	17	562	72	615
CCA74023.1|AA3_2	3.85e-120	17	554	74	605
BCS29521.1|AA3_2	1.92e-115	32	560	94	618
UPK99788.1|AA3_2	3.11e-111	32	560	86	609
QRD03692.1|AA3_2	6.81e-111	17	566	77	622

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.24e-98	36	560	58	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	1.10e-76	37	559	94	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	2.67e-55	36	560	58	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.38e-54	36	560	59	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	2.48e-50	38	560	63	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	6.86e-82	36	561	90	615	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	5.91e-76	28	561	97	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	5.91e-76	28	561	97	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	2.03e-68	33	560	99	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|P0DO29|ERIK_HERER	9.91e-57	36	561	90	597	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999991	0.000029

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_376256-t33_1-p1.