CAZyme Information: ASPVEDRAFT_36989-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_36989-t33_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
992	KV878125|CGC45	111654.00	4.5901

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878125:4668411-4671598(-)

Full Sequence      

MMMLWFLFFTTCLALLEQEIVVFEPQQGVLAIHDATILYDAQDPVSIDIATKSLAEDLHA
ITGHMPPRTAVNETNPPSLNSSQTAIIAATVDSTIIRTLEKKGLLDVSDIRGKWETFRTA
VVRDYQPGRDAFVIAGSDKRAVVYGIYTLAEQCGQSPYHWWADVSATRRDAIYALPITTT
HGEPSVKYRGLFINDEAPALTGWWSKKHGVDHYPLDSEFYRHVFDLILRLKGNFLWPAMW
ASYVPPPGNIFFTDDPENQKLADDYGVVVSTSHHEPMQRATNEWNSSETGEWDWNENKEN
VTRFMEEGVRRAGRAETYFTLGMRGAGDSAISGPDPIEVLEDVFETQRGILAEQYGNASA
AKQVWTIYKEVATYYAQGLEPPEDVTMMFTDDNWGNVMRLPTAEEAARSGGIGLYYHFEY
VGTPKSYKWHNTNNLAKVYKELSQALQRGADRIWVFNVADIKPMELPFAFAMDLAWNASR
FDFDVVPEYLRAFASRELGQEHAEEIASILLRHSHLIGRRKYEGITSATYSFYNYHEVER
VLADWEELGSRVMDIRHSIPADGQAAFLQLVQYPIQAGLFYHRIVLGQTINQQFAIQRRN
SANTIAQDVLAASEEDADLREELHSILDGKWNGMMDQPKLEEWQYETWLYPARDIIQNLS
FVQRRQDFVYALGNLGIYAEGSESAARQSYVCESCDQTRPTVDSRAPTLQAVDPYGPLNR
TVDIFHRGDYRKPISFNVSAPYTWINISPGSGTITGKHPEVRLIVSIDWSSVPEGFNETV
PVAVYYDTLPNFDNLHVPILNRPALPEDFSGFPATNGYISIEAAHFQRASKDTVSFEVLP
NLGTRTESGAIGLRPYKAARASSTSAKGASVEYNIYLFDSTESLTATIYLTQNLDTDPSL
PMQYSLSIDSSEADFTRLLQEPETAGDLPDIWTDQVEDGVWTVEVELGPVSAGAHKLTWR
VNSPEVYLEKVVLDTGNAVRDSYLGPPETKLV

Enzyme Prediction     

EC	3.2.1.131:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	33	660	1.6e-224	0.836441893830703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406396	Glyco_hydro_115	0.0	182	523	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
407695	GH115_C	2.08e-49	811	988	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC81939.1|GH115	0.0	14	989	21	1017
EAA66396.1|GH115	0.0	10	988	17	865
BAE63119.1|GH115	0.0	14	992	18	972
QKD58010.1|GH115	0.0	9	966	20	989
CDP27858.1|GH115	0.0	12	992	17	1019

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	3.01e-174	33	986	21	930	Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	2.19e-130	37	648	28	635	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.14e-129	37	648	27	634	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	6.40e-129	37	648	55	650	Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
6NPS_A	4.28e-107	16	992	7	966	Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

ASPVEDRAFT_36989-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.072759	0.927201	CS pos: 14-15. Pr: 0.6675

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_36989-t33_1-p1.