CAZyme Information: ASPVEDRAFT_36812-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_36812-t33_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	KV878125|CGC20	33242.14	4.7647

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878125:4219908-4221024(+)

Full Sequence      

MRVAGLITLLAAAMPAVATRGTFGLALGNENPDASCKSTEDYKKDFDALKDLTTLVRTYS
ASNCNTAKNIVPAAKAKNFKVVLGVWPDTEESFNQDFNALKKSVKGNEDVIHAITVGSEA
LYRGDMKAQDLLKRINQVKEEFDGVQVGMVDSWNKFADGTADPIIQGGVTYFLANGFAYW
QDQDISNATATYFDDMAQAKARIEQVAGDNAKKIRFGNGESGWPTDGGSDYGKAKASTDN
AKKYYKNAVCPMLKWGIDVFYFEAFDETWKPDSTGDNGEPMDETHWGLFTDKRTAKFDTA
CPN

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_36812-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	27	301	3.7e-39	0.9839228295819936

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.22e-64	16	293	39	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.41e-41	28	301	9	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25884.1|GH17	1.82e-221	1	303	1	303
EAA66273.1|GH17	8.29e-185	1	303	182	485
BCR86239.1|GH17	8.55e-157	1	302	1	306
CAK45395.1|GH17	9.45e-157	1	301	1	301
QMW46467.1|GH17	8.61e-156	1	303	1	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	7.34e-39	23	296	38	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	5.58e-38	23	296	38	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	9.58e-116	10	301	11	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P15703|BGL2_YEAST	9.20e-71	17	301	21	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	1.01e-68	7	301	6	305	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	1.61e-67	7	301	6	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|O13990|BGL2_SCHPO	2.10e-65	19	301	38	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000208	0.999743	CS pos: 20-21. Pr: 0.9239

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_36812-t33_1-p1.