CAZyme Information: ASPVEDRAFT_30745-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_30745-t33_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	KV878131|CGC16	38824.12	4.4344

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878131:1043698-1044918(+)

Full Sequence      

MVALPRTLAVLLSALIAANAEKAHQWGPSEWKGLVTFGNSYTDDSRLGYFASNNGTAPPV
GWKQPVSNDSASGGYTWGHFASQIANLTRYNYAVSGAVCSNEISPRTFDTINAPFPSVLE
YEIPAFLADSKHTEPNGDDFINIGPNETVYAIWIGTNDVGNNAFLTDSQVKGAVIPDFIE
CVYEALDAVYANGGRHFVIMNLAPLQLAPQYATPENGGLNSTSGYPDKGANITEISYRMW
ETVVTANDVFHYKTAYESKIANRYPGAQLAVMDMYGLISDIWHNPTEYLASPSNVTGYVK
HCDEATGDCERLPNEEAFLWFDELHPSERVDKVIGREFVNLVSGNNSRWAAYW

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_30745-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	34	338	2.1e-71	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	2.24e-46	34	340	2	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.08e-14	91	340	79	313	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	3.36e-09	32	341	2	280	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
225780	COG3240	4.34e-07	8	335	6	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
395531	Lipase_GDSL	1.03e-04	34	338	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29966.1|CE16	1.40e-257	1	353	1	353
QMW44554.1|CE16	4.61e-159	5	353	5	353
QRD84022.1|CE16	4.61e-159	5	353	5	353
BAE62044.1|CE16	4.61e-159	5	353	5	353
QMW32524.1|CE16	4.61e-159	5	353	5	353

PDB Hits     

ASPVEDRAFT_30745-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	4.53e-85	6	353	2	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999757	CS pos: 20-21. Pr: 0.9793

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_30745-t33_1-p1.