CAZyme Information: ASPVEDRAFT_30737-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_30737-t33_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618	KV878131|CGC18	66424.84	6.3437

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878131:1025329-1027320(-)

Full Sequence      

MTLSDTPGSAICSLEEFLQVSYDYIIIGGGTAGLAVAAGLSEDPAVNVGVIEAGKDQTQN
ECVSTPALFPRILGVPEYDWMLATVPQEGNRGKVHALTRGKMLGGSSATNGMMYVRGSKQ
DYDDWSAFGKGWSWSSMAPYFRRHEGFDDTPGGGVSSGTNITNYQSGSHGRFGPVQTSFN
NWRSPVERNFIEAGKQASGIAGPRDPGGGDHLGFFSSLTTIDRKVRKGTRSYAATAYLLP
NTRRPNLRVLTEALAIKVILQGNVARGVRIHCAGQTYDIKATREVILSCGTYKSPQILEL
SGIGDPKILAPAGVQCTISLPGVGASLQDHVLTAAIYELKDGFSSFDSLRHAQNLQEHLD
MYAKDSTGILGAATSGMGFLPYSKMVSPAELERTCQKIVETPGKTPFEGKQLEQVVKQLK
SPISGNIQFIFMQGTMNVEEVAGDQTKFQKQLSENDRDGFTIVSCVEYPASRGTVHITSS
DPAKNPAVDPAFLGHSADVDVLATALGFSDKIAQSPALKDNIHRRAYPSEHVDVHDHASA
SEAVRDFCLTEYHPCGTCAIGQVVDERLKVYGVQGLRVVDASVFPGNVSGNILSTVYAVA
ERAVDLIKEDAVRFRSDL

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_30737-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	21	610	6.3e-169	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.65e-109	21	608	5	532	choline dehydrogenase; Validated
225186	BetA	8.59e-109	21	611	7	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.16e-35	469	603	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.39e-34	97	330	21	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.14e-17	21	586	55	558	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29957.1|AA3_2	0.0	1	618	1	618
BCS21673.1|AA3_2	3.14e-178	1	610	1	614
QQK46529.1|AA3_2	3.38e-172	12	610	7	608
UJO22487.1|AA3_2	1.45e-170	15	608	20	617
UJO21990.1|AA3_2	7.66e-168	3	614	2	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	3.42e-66	21	611	5	568	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	5.86e-65	22	610	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6ZE2_A	2.10e-64	21	610	5	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3FIM_B	8.34e-64	22	610	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3T37_A	3.22e-54	23	601	19	514	Crystal structure of pyridoxine 4-oxidase from Mesorbium loti [Mesorhizobium loti]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	7.10e-150	10	610	2	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	7.10e-150	10	610	2	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.54e-142	13	610	5	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	6.31e-83	2	610	16	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q988C9|4PADH_RHILO	5.82e-80	21	607	6	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998134	0.001876

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_30737-t33_1-p1.