CAZyme Information: ASPVEDRAFT_28651-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_28651-t33_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		39286.08	3.9563

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878129:55348-56650(-)

Full Sequence      

MKASIFQLLCLNAALASAQVVSGAAEGFAAGVTGGGDVSPSYPETNEELVALLESDEPQV
IVLTKTFEFIGTEGSTTEDGCAPWGTGESCQLAINANGWCGDNPVATVTYDNAAMNSIRI
KSDKTLVGEGDTGVLSGKGLYFDGGISNVIVQNIKITNMNPHLVWGGDAFTFFGADQIWI
DHCETSLIGRQHFVTGFNPNTRMTWSNNFLNGETTHSAGCDDYHYWTLELVGVGDEITFQ
NNHVYHTTGRGPALSGTTLFHAVNSVWSDIPGHAIEGGDQGRGLFEGCYFTDVSEIAPAE
PENQLFSASDENAASCESALGRACESNGYSGSGAFDSSNADFFGDFADLTIAPAGSATDA
LAYVPENCGIGRI

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	107	291	3e-73	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	7.26e-48	107	294	3	190	Amb_all domain.
366158	Pec_lyase_C	3.10e-07	111	290	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
226384	PelB	4.20e-07	118	295	97	278	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19434.1|PL1_4	2.02e-267	1	373	1	373
AAW03313.1|PL1_4|4.2.2.10	1.19e-242	1	373	1	373
CAK48388.1|PL1_4	4.68e-241	1	373	1	373
BCS16152.1|PL1_4	1.74e-236	1	373	1	373
BCS04576.1|PL1_4	1.74e-236	1	373	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	6.91e-112	21	373	3	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.28e-109	21	373	3	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	9.51e-107	21	372	3	359	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5MBK3|PELC_ASPNG	2.11e-243	1	373	1	373	Probable pectin lyase C OS=Aspergillus niger OX=5061 GN=pelC PE=3 SV=1
sp|A2QW65|PELC_ASPNC	8.31e-242	1	373	1	373	Probable pectin lyase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelC PE=3 SV=1
sp|B8N6W5|PELA_ASPFN	1.27e-130	13	373	15	375	Probable pectin lyase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelA PE=3 SV=1
sp|Q2UCT7|PELC_ASPOR	1.27e-130	13	373	15	375	Probable pectin lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelC PE=3 SV=1
sp|Q5BEB9|PELC_EMENI	4.45e-123	8	369	5	370	Probable pectin lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000283	0.999689	CS pos: 18-19. Pr: 0.9301

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_28651-t33_1-p1.