CAZyme Information: ASPVEDRAFT_28574-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_28574-t33_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	KV878128|CGC3	48744.57	3.8495

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878128:2419271-2420746(-)

Full Sequence      

MTPLGRVLLALAVPRAVLSASSIEVDTSSLLQEIHGFGFSQAFGRASEFEAASADLQQQA
LDLLFSTETGAGFSIIRNNIPSSVDSTIEPESPGSPSATPNYTWSGDDAGQVWFTKQAVS
YGVSTIYANAWSAPGFMKTSGDEAAPGYLCGTTGHNCTSGDWRQAYANYLVQYVKYYVSE
GLPITHLGFLNEPDYETSYSQMQISSDAAEAISFIPTLYQTVQDADLDLNITCCDAIGWD
GQETYTTALNAAGMDEYLSTITSHMYTSDATSAIDTSLPTWLTEAGVETSDAPFTTTWHD
SGAPNEGMVWASKLATGFIDAKLSAYLFWEGFEIDERQSASHLVDVGSSGAAEGSGIFYA
FSMWSRFIRPGAHRVETSGSVDDVATAAFVNTDGSVVVVLTNSGDVTQTVQIGVSVDFTA
ADAWVTDNDRQIAETNVTVSGGSVGLDVPAQGVVTVKLA

Enzyme Prediction     

EC	3.2.1.8:3	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	21	456	7.6e-172	0.9909706546275395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	7.64e-21	17	455	29	425	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
405300	Glyco_hydr_30_2	1.60e-10	20	240	1	232	O-Glycosyl hydrolase family 30.
407314	Glyco_hydro_30C	1.15e-07	371	456	1	63	Glycosyl hydrolase family 30 beta sandwich domain.
307945	Glyco_hydro_30	4.01e-07	34	193	1	158	Glycosyl hydrolase family 30 TIM-barrel domain.
396577	Glyco_hydro_59	1.48e-04	59	329	26	251	Glycosyl hydrolase family 59.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23084.1|GH30_7	3.82e-257	1	458	8	416
UKZ54336.1|GH30_7	1.91e-207	8	457	11	458
UKZ80109.1|GH30_7	1.91e-207	8	457	11	458
QYT05008.1|GH30_7	1.52e-204	19	457	20	458
UKZ91355.1|GH30_7	3.11e-187	21	458	25	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M5Z_A	5.65e-131	9	455	11	450	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	4.99e-109	19	458	1	447	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	9.88e-108	19	458	8	454	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6IUJ_A	3.42e-100	21	451	22	464	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	3.65e-99	23	451	95	535	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	6.91e-109	19	458	25	471	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|O16580|GLCM1_CAEEL	9.35e-10	23	409	87	488	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2
sp|O16581|GLCM2_CAEEL	1.46e-07	18	402	82	479	Putative glucosylceramidase 2 OS=Caenorhabditis elegans OX=6239 GN=gba-2 PE=3 SV=2
sp|Q45070|XYNC_BACSU	6.39e-06	17	455	30	417	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.199318	0.800670	CS pos: 19-20. Pr: 0.7630

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_28574-t33_1-p1.