CAZyme Information: ASPVEDRAFT_26349-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_26349-t33_1-p1
• CAZy Family: GH154
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
270		28385.53	4.1274

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878126:4458895-4459707(-)

Full Sequence      

MYQLAILQTLLALSALPSVYAANSPGCGNQPSLTNGVHQINGREYTLKLPDNYDPSNPYH
LIFGLHWRGGNMDNVVNGESIQPWYGLESRAQGSAIFVAPNGLNAGWANTNGEDTALIDA
IIEQVEADLCIDQASRFATGFSWGGGMSYALACARASEFRAVSVLSGGVISGCDGGNDPI
AYLGIHGINDPVLPWDGGVELAEKFVANNQCQPAQIGQPAPGSGDSVRTDFTGCSRPVSF
ISYDGGHDAAPLGVQSSLAPDATWEFFMAA

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_26349-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	43	171	3.4e-23	0.5814977973568282

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	2.75e-13	42	267	46	304	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
223489	DLH	4.96e-07	116	196	94	175	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
226584	COG4099	3.06e-06	45	204	176	340	Predicted peptidase [General function prediction only].
224423	DAP2	3.01e-05	38	169	376	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSB17085.1|CBM2|CE0	1.00e-93	26	267	38	285
EGX54170.1|CBM1|CE0	8.54e-89	22	267	92	352
SHH50044.1|CBM2|CE0	1.70e-83	21	267	49	311
AVT34021.1|CBM2|CE0	2.87e-83	22	267	24	273
AVT41696.1|CBM2|CE0	5.74e-83	22	267	24	273

PDB Hits     

ASPVEDRAFT_26349-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QYU7|FAEC_ASPNC	1.68e-171	7	270	7	270	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
sp|Q5B2G3|FAEC_EMENI	1.96e-170	1	270	1	270	Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=faeC PE=1 SV=1
sp|B8N7Z6|FAEC_ASPFN	1.83e-159	6	270	6	270	Probable feruloyl esterase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=faeC PE=3 SV=1
sp|Q2UI81|FAEC_ASPOR	6.11e-158	6	270	6	270	Probable feruloyl esterase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=faeC PE=3 SV=2
sp|A1DI08|FAEC_NEOFI	2.55e-155	6	270	6	272	Probable feruloyl esterase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=faeC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000197	0.999767	CS pos: 21-22. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_26349-t33_1-p1.