CAZyme Information: ASPVEDRAFT_205291-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_205291-t33_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561		61464.54	5.6484

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878125:95820-97652(+)

Full Sequence      

MGEQENLYDFIVVGGGPAGCTVATSLAKAAAKPSVLLLEAGGSNGAKNLRIDGRRWCTFI
EQAPSMNWGLKTAPLTECNGRQIDYSTGKGLGGGSAINFGVFAVGARDDYEAWAEIVEDS
NFAWRKMQERIKRLESFSGLKDDLVKGNHGYDGPLKVGYAKQWDRDLVPLLDSFVEAGLQ
RNLDHNSGNPLGLGLTINSACNGRRTTAADMLARAPDNLVVVTDSPVQRVQLDGKKAVGV
ETKGRKYFARNEVILSTGALVTPKILMHSGIGPASQLANFNIPVVHDLPAVGQGLKDHPF
APMILARDPSTNDRNSFFQDKKAMADAFEQWEEDGTGPWACYGCQIGSGWLKSDRITSSA
EFKALPSATREFMTRETIPQYELITNFPVHLVLPDLFQDYSYICLTMFLMNQQSTGEVKL
QSANPDDPLLLDPKFLEHPFDRRACIDIYRHVLELTKHPAIAKDTTATILGSKSESDEDI
LEHWKNNLSSSWHMAGTVKMGKDDKDAAVNSRFQVFGVERLRVADMSAVPLLTNNHTQAT
AYLTGATCADVLIGEYNLNET

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_205291-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	553	8.9e-143	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.11e-92	1	555	1	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.34e-80	8	554	6	533	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.93e-36	413	548	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.03e-36	2	545	50	569	Protein HOTHEAD
366272	GMC_oxred_N	1.17e-25	78	299	14	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19530.1|AA3_2	0.0	1	560	1	568
CAK46531.1|AA3_2	5.53e-258	1	561	1	568
BCR99292.1|AA3_2	2.31e-252	1	559	1	566
BCS11595.1|AA3_2	2.31e-252	1	559	1	566
BCS25214.1|AA3_2	3.32e-249	1	559	1	570

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	1.32e-45	8	557	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6YS1_AAA	1.67e-41	8	561	8	569	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5OC1_A	1.94e-41	8	552	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.97e-41	8	552	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZH7_A	4.27e-41	8	561	8	569	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A075TRK9|PATE_PENEN	7.97e-60	4	542	48	614	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	1.66e-59	8	542	46	583	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	5.41e-57	8	542	51	614	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	6.99e-56	7	558	1	533	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q00593|ALKJ_PSEOL	1.05e-53	7	553	1	528	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_205291-t33_1-p1.