CAZyme Information: ASPVEDRAFT_204699-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_204699-t33_1-p1
• CAZy Family: GH13|CBM20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351		40783.85	8.5550

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878141:241659-242855(-)

Full Sequence      

MRRSLLVFFLVGILTIFLLVRSVWTLLSLLIEDAAADAIHRAELPRVNSSLTDQRPHIIP
KIIHQTYKNETIPEVWAGAQQSCINLHPDYEYILWTDAKSRQFIAAEYPWFLATFDGYKY
PIQRADSIRYFVLAHYGGIYIDLDDGCNRPLDPLLAYPSWLRRTVPTGISNDAMGSAPQH
PFFLKVIKSLQQYDRHWGLPYITVMYSTGPLFLSVIWKEYMKDSPSETNRVRILMPDEYK
NNAWSFFTHHTGNSWHRNDARLIFWMGQHWQLLTLCGFLFAAAAVVGLFWAYTQIMGLKG
EYRYHSPTPSSGIWSSPSRRARYMMPPLPWRRSVKGDEESEALIELGRRDD

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	155	3.2e-23	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.73e-75	59	282	82	307	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.25e-28	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25423.1|GT32	3.01e-213	1	351	1	345
QQK45416.1|GT32	2.58e-185	1	351	1	359
CAP86500.1|GT32	1.26e-183	1	351	1	360
BCS14035.1|GT32	3.48e-183	1	345	1	349
BCS02358.1|GT32	3.48e-183	1	345	1	349

PDB Hits     

ASPVEDRAFT_204699-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	2.48e-103	1	292	1	288	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	6.62e-102	1	305	1	310	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	7.25e-91	48	279	46	278	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	6.62e-89	58	278	81	304	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	1.32e-57	59	283	64	289	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.707566	0.292436

TMHMM  Annotations     

Start	End
5	27
270	292