CAZyme Information: ASPVEDRAFT_199430-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_199430-t33_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578	KV878134|CGC8	64254.40	6.7223

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878134:118789-120803(+)

Full Sequence      

MTSSLPSKTYADPDYEAAHRETFAAPKTKIPDVLPIGVTKATFDAAIKDLVSAVGLASVF
VGEALAHYVDPYDVYEDDESRRRVPSAAVTPGSLDELRQVLKIANKHEIPLWTFSRGKNL
GYGGPAPVVRGSIALDLHRMNRILEVNDDMHYAVVEPGVTWTDLYNYCVENKKKVWPSTP
SLGWGSVIGNTVDRGTGFGSNSNHHQCVAGCEVMLADGDLVRTGQFGISNSPSAFLSKFT
FGPSIEGLFWQSNLGIVTKMSIWLTPQPSAFMSCVFNMPKFDDLEIMVDTLGLMRRNGVI
PNVIWIGNIVEALCIRGRRRDYWNGEGPIPDWRVKQLQEELKLGCWTARFGLYGPRRIVQ
AHFDEISEILKDKAPTGELIGKLFTGDNGGLLDAASVPFEDGNVLVGVPSLISIPLMKWP
LKDDNVGKAAHGDYAPIIPSSGKRLLDWMRRAKTVFEASGLELMTDFFMHERHVVVTGMY
SFDQHSPVEREAVHRLFHALHEEAKDKGYGMYRGHIQHMDLIADLNDFNDHAYTRFVETL
KDAIDPNGILAPGKQGIWPYKYRHLRGKTGSAAPKEKL

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_199430-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA4	32	564	4.3e-144	0.9885057471264368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.62e-32	85	224	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	1.44e-23	63	555	7	455	FAD/FMN-containing dehydrogenase [Energy production and conversion].
178402	PLN02805	5.42e-12	84	283	133	323	D-lactate dehydrogenase [cytochrome]
183043	PRK11230	1.96e-09	75	301	44	261	glycolate oxidase subunit GlcD; Provisional
397178	FAD-oxidase_C	0.001	443	554	138	247	FAD linked oxidases, C-terminal domain. This domain has a ferredoxin-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17805.1|AA4	0.0	1	578	1	578
VBB71413.1|AA4	3.52e-281	8	566	7	569
UPK94077.1|AA4	1.27e-267	1	566	1	566
CDP22417.1|AA4	8.29e-263	8	541	7	544
QGA13141.1|AA4	1.15e-240	1	571	1	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FXD_A	2.00e-98	34	563	5	522	Crystal structure of eugenol oxidase in complex with isoeugenol [Rhodococcus jostii RHA1],5FXD_B Crystal structure of eugenol oxidase in complex with isoeugenol [Rhodococcus jostii RHA1],5FXE_A Crystal structure of eugenol oxidase in complex with coniferyl alcohol [Rhodococcus jostii RHA1],5FXE_B Crystal structure of eugenol oxidase in complex with coniferyl alcohol [Rhodococcus jostii RHA1],5FXF_A Crystal structure of eugenol oxidase in complex with benzoate [Rhodococcus jostii RHA1],5FXF_B Crystal structure of eugenol oxidase in complex with benzoate [Rhodococcus jostii RHA1],5FXP_A Crystal structure of eugenol oxidase in complex with vanillin [Rhodococcus jostii RHA1],5FXP_B Crystal structure of eugenol oxidase in complex with vanillin [Rhodococcus jostii RHA1]
1E0Y_A	2.18e-96	31	568	9	559	Structure of the D170S/T457E double mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum],1E0Y_B Structure of the D170S/T457E double mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum]
1DZN_A	6.05e-96	31	568	9	559	Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum],1DZN_B Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum]
1W1K_A	1.20e-95	31	568	9	559	STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum],1W1K_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum]
1W1J_A	1.68e-95	31	568	9	559	STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: The505Ser Mutant [Penicillium simplicissimum],1W1J_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: The505Ser Mutant [Penicillium simplicissimum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P56216|VAOX_PENSI	1.71e-94	31	568	9	559	Vanillyl-alcohol oxidase OS=Penicillium simplicissimum OX=69488 GN=VAOA PE=1 SV=1
sp|P09788|DH4C_PSEPU	5.69e-87	33	557	8	515	4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida OX=303 GN=pchF PE=1 SV=3
sp|P94535|GLCD_BACSU	4.11e-19	75	301	31	247	Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) OX=224308 GN=glcD PE=3 SV=1
sp|P9WIT1|Y2280_MYCTU	1.20e-15	54	315	12	260	Uncharacterized FAD-linked oxidoreductase Rv2280 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2280 PE=1 SV=1
sp|P9WIT0|Y2280_MYCTO	1.20e-15	54	315	12	260	Uncharacterized FAD-linked oxidoreductase MT2338 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2338 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000040

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_199430-t33_1-p1.