CAZyme Information: ASPVEDRAFT_180822-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_180822-t33_1-p1
• CAZy Family: GH11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407		44676.91	4.1351

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878125:104199-105602(+)

Full Sequence      

MAAISKLIAWSSMLVLAQSTRIERRWNNSIGLTPHMGWSSWNVAQCDSASEKYALDTANR
FVELGLKDLGYTYINIDDCWSTKERDGEGNLVPDPTKWPNGIRAVVDQIHDMGLKFGLYG
CAGELTCASYPGSQGHEVQDAQLLASWDIDFWKHDNCFTPCTTEPPPQTCWEDSVDTRPW
YVTMHDALQSVSDTKAILFNMCQWGRNEVWTWGAPLGHSWRIEGDNWGDWESVIRIGARA
SDISEFSGPGGFNDLDMLFVGNGVLTEPQERLHFGLWAITKSPLVIGADLNTIPETSLAI
LTNKDIIDINQDELGIAAGIFQPPSAPAPVAGEIYPYWAGRVSDGVVIAFAAASGGGEFS
VNFVDVPGLQSGPYEWKELYSGETGTGEGITFDVADDDFAIFKVTTA

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_180822-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	130	346	1.5e-58	0.8296943231441049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269893	GH27	6.29e-120	34	312	1	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
166449	PLN02808	1.78e-88	7	316	2	299	alpha-galactosidase
177874	PLN02229	6.83e-86	27	316	56	329	alpha-galactosidase
178295	PLN02692	1.75e-83	28	318	50	325	alpha-galactosidase
374582	Melibiase_2	2.56e-72	33	312	1	284	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS30777.1|GH27	1.10e-295	1	406	1	406
VBB84423.1|GH27	5.48e-191	9	404	3	400
AFJ59927.1|GH27	5.02e-190	9	407	4	406
AEO62124.1|GH27	7.13e-190	9	407	4	406
ARI48112.1|GH27	1.92e-186	27	407	22	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UAS_A	4.30e-78	28	316	3	276	Chain A, alpha-galactosidase [Oryza sativa]
3LRK_A	2.20e-76	28	318	24	324	Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae],3LRL_A Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae]
6F4C_B	7.74e-76	27	316	2	276	Nicotiana benthamiana alpha-galactosidase [Nicotiana benthamiana]
3LRM_A	3.37e-75	28	318	24	324	Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae],3LRM_B Chain B, Alpha-galactosidase 1 [Saccharomyces cerevisiae],3LRM_C Chain C, Alpha-galactosidase 1 [Saccharomyces cerevisiae],3LRM_D Chain D, Alpha-galactosidase 1 [Saccharomyces cerevisiae]
1SZN_A	2.80e-74	31	404	9	410	Chain A, alpha-galactosidase [Trichoderma reesei],1T0O_A Chain A, alpha-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Y865|AGALB_ASPNG	2.16e-83	28	356	21	377	Probable alpha-galactosidase B OS=Aspergillus niger OX=5061 GN=aglB PE=2 SV=1
sp|A2QEJ9|AGALB_ASPNC	1.70e-82	28	356	21	377	Probable alpha-galactosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=aglB PE=3 SV=1
sp|Q9P4V4|MEL_ZYGMR	5.05e-82	12	350	3	359	Alpha-galactosidase OS=Zygotorulaspora mrakii OX=42260 GN=MEL PE=3 SV=1
sp|O94221|AGALB_PENSI	1.51e-81	8	343	5	364	Probable alpha-galactosidase B OS=Penicillium simplicissimum OX=69488 GN=agl1 PE=2 SV=1
sp|P14749|AGAL_CYATE	2.14e-81	28	372	50	372	Alpha-galactosidase OS=Cyamopsis tetragonoloba OX=3832 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000752	0.999224	CS pos: 17-18. Pr: 0.9280

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_180822-t33_1-p1.