CAZyme Information: ASPVEDRAFT_179903-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_179903-t33_1-p1
• CAZy Family: GH109
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574		62683.48	4.9550

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878140:113432-115260(-)

Full Sequence      

MASPFDFIVVGSGPAGSTVASKLANSPKAPTVLLLEAGGPNADPNLRVDGQRWLTFQNKD
MNWGYKTTPQEHCNNREIDYSRGRGMGGSSAINFGVYSVGARDDYNEWARLVDDDSFAWE
PVQARFKALETFHSGVPAGLDAKYAAPAAGDHGSAGPLHVGFAQEWERDLPELLDVFEQA
GFPLNPDHNSGNPIGMSVLINSAANGRRSTAADLLQPQPANLTVITNAPVQRLVLEGKKA
VGVEADGTKYYAAKEVVLCAGSLEDPRILMHSGIGPAKQLEEFNIPVVQDAPAIGQALKD
HCFVPIVNTRVENSTQRKEFYGDEEAMASALEQWKKDGSGPWSKFACELGIGWFKLDRLT
SSAEFQALPEDQKRFLLQTTVPHYEVLTHFPIHWFIPGFAKEALNYSCLLVFLFNSQVNG
EAVLQSADPNTPLKFDPKFLSHPFDRRAAIESLRDSLRIAQYDGYTKDNVQQLAGPKSDS
DEDLLEYWRENISSSWHMTGTVKMGKPGDAEAVVDKDFRLIGIENLRVADMSVVPVLSNC
HVQAVAYVTGATAADKLIREYQLDTAGAAGVGKL

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_179903-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	558	5.8e-145	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.03e-93	1	560	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	8.85e-84	1	559	2	532	choline dehydrogenase; Validated
274888	Rv0697	1.68e-58	6	554	2	483	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	5.98e-33	424	553	9	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.95e-31	73	301	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23517.1|AA3_2	0.0	1	574	1	572
QMW33321.1|AA3_2	0.0	1	563	1	563
QMW45359.1|AA3_2	0.0	1	563	1	563
UDD61192.1|AA3_2	0.0	1	563	1	563
QRD84914.1|AA3_2	0.0	1	560	1	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	6.12e-57	5	555	2	559	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.24e-57	5	555	3	560	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3Q9T_A	1.18e-50	3	562	5	574	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.63e-50	3	562	5	574	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	2.25e-50	3	562	5	574	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	1.10e-63	5	555	41	605	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|B9JBA2|BETA_AGRRK	1.21e-60	6	563	4	531	Oxygen-dependent choline dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) OX=311403 GN=betA PE=3 SV=1
sp|A6X2G7|BETA_BRUA4	1.22e-58	6	558	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|Q2KB43|BETA_RHIEC	3.27e-58	6	563	4	531	Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) OX=347834 GN=betA PE=3 SV=1
sp|B5ZUG2|BETA_RHILW	4.53e-58	6	563	4	531	Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) OX=395492 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000003

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_179903-t33_1-p1.