CAZyme Information: ASPVEDRAFT_173600-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_173600-t33_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651	KV878132|CGC11	73361.83	6.2963

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878132:851062-853283(-)

Full Sequence      

MSSWADPPSNIVYAGISSLFTEDSSTRFAIVIRSSSELVNFFECTLPCQDRQEAATEVPI
LVLDKLIQYRNVFHEKIAGIALPRELSQRCPSLATKLWEVLDAVPLVIEQEKHRRAKGDQ
GELATFLGWDEKQMDEQADSMVRKCIRYFGVGHIPLVRLDLHGMVGVDNDFRVHLVDEMG
YQRTVDDSTWRLASYYADDLKQRQAKVAFFSVTPHARPDLPTRHALIRFSRCLRVDFKWY
VPRPRPQLLPIVRKVENILHCANTQGAHLAVDEELRILEWVYTTAKRYWLNDDGPLRPRS
KGGADVVVISDAILSPLALISKQSDPKRPVIFENRLHVHDGSVNDTSSAEYQTWDFLRAR
LKDVDLLVCQEPKGLAPPLMLEKDAGYISPAIDQLDGRTKRLHDWDVTFYGREFNAICRL
GGRPVIDYPHEQYILHLAQLVPDEGTLCLLDAYKKFHQRREADSPGRPVPKLLLCHSSSP
NDDDRAPVYASIITHIENTMPQLAQSITIIQLRPPDQLWNVLISKAMAIVQLNDSEGIPE
MLLGAAQKGKPVIVGEKCGYLSFLKEEVGAIVLDGDCTEGIAHHLLRLAADMARGKSQPG
TEGSTALNARYTTVGNAVSWFYLASKLSKGEVVELGERDVYTLAEEERRDS

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_173600-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340823	GT4_trehalose_phosphorylase	5.37e-89	206	627	1	378	trehalose phosphorylase and similar proteins. Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose. The catalyzing activity includes the phosphorolysis of trehalose, which produce alpha-Glc-1-P and glucose, and the subsequent synthesis of trehalose. This family is most closely related to the GT4 family of glycosyltransferases.
340831	GT4_PimA-like	1.98e-06	429	591	190	333	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223515	RfaB	6.08e-04	422	591	190	342	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17638.1|GT4	0.0	1	648	1	648
QKX63329.1|GT4	8.99e-260	7	645	3	642
EAA59389.1|GT4	6.26e-252	11	649	119	762
CAK47237.1|GT4	1.47e-199	3	647	12	653
BCR98080.1|GT4	5.52e-198	3	647	12	653

PDB Hits     

ASPVEDRAFT_173600-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6YRN9|TREPH_PLEPU	7.01e-74	12	634	43	705	Trehalose phosphorylase OS=Pleurotus pulmonarius OX=28995 GN=TP PE=2 SV=1
sp|O75003|TREPH_GRIFR	2.20e-70	12	624	39	687	Trehalose phosphorylase OS=Grifola frondosa OX=5627 PE=1 SV=1
sp|Q9UV63|TREPH_PLESA	8.09e-70	12	634	43	717	Trehalose phosphorylase OS=Pleurotus sajor-caju OX=50053 GN=TP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_173600-t33_1-p1.