CAZyme Information: ASPVEDRAFT_172603-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_172603-t33_1-p1
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446	KV878131|CGC6	50597.91	6.4383

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878131:1388229-1389659(-)

Full Sequence      

MPFRPPQSSLFRFLGAGAVLSLILLAFVTFGHLEGYGFSSGYVIKDKASSNLLSPEQCVE
AQVNSTGEWEFDARRDADNHGLSEGQCLSAFPKLFADVDRSAEARAKGEKGAITFKEVDE
AGKIEENGMVRAVIKGGELYVLDFGNMQYTFSRGKATLSSLNRALAAYPDRKNLPDIEFV
FSTDDFSTGQSPVWTYSKHPDEEGVWLMPDFGYWSWPEVKVGSYKEIRERIVDVDEGDGT
KYYRGLRFQDKKKQLAWRGSVGTNADVRGRLIEASRGKSWASIYEINWGDPAHVKANLLP
MEEYCRYMFLAHTEGRSFSGRGKYFLNCRSVLVSHKLEWLEAHHGAFISSGPDANFVEVE
RDFSDLDKKMAFLIDNPETAERIAENSVRTFRDRYLTPAAESCYWRHLIRKYAASCDFEP
VLYKTTRTGKRVDRGVHFESWILESH

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_172603-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	174	413	6.1e-26	0.972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	5.44e-26	131	420	40	327	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	5.15e-20	174	413	2	250	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS30108.1|GT0	0.0	1	446	1	446
BCS13796.1|GT0	1.09e-193	7	443	7	439
BCS02108.1|GT0	1.09e-193	7	443	7	439
UDD61446.1|GT0	5.12e-191	1	445	1	438
QMW41857.1|GT0	1.14e-185	1	445	1	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	2.87e-08	174	419	128	382	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q29AU6|RUMI_DROPS	8.80e-09	174	419	138	392	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|A0NDG6|RUMI_ANOGA	3.54e-08	174	412	138	382	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1
sp|Q8T045|RUMI_DROME	1.51e-07	174	419	140	394	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999998	0.000008

TMHMM  Annotations     

Start	End
9	31